KEGG   Larimichthys crocea (large yellow croaker): 104936038
Entry
104936038         CDS       T04659                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X8
  KO
K04462  ecotropic virus integration site 1 protein
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104936038 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    104936038 (mecom)
Transcription factors [BR:lco03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    104936038 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED zf-met Zn-ribbon_8
Other DBs
NCBI-GeneID: 104936038
NCBI-ProteinID: XP_010750288
Position
VII
AA seq 1257 aa
MRSKGRARKLATSDGDDEFALYPSDILDDVCGSGDPAPSSTLAEDPASPPLSDDEASPQD
PLLFQQQSIFLPQEDLTIPLDFELRESAVPGGGLGIWSRRRVNIGERFGPYEGEHRPCLR
DPAQGWEILDGSGHVKFCVDASKPDIGSWLKHIQFAPAAKQHNLTACQIDDQIFYKVTRE
IFPGEELLLFMKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKQPCGMPPSS
FLNPGGDSDLKAQEPQDLRPLHVSHGLHECKECDQVFPDIQSLEAHTLSHSEEREYKCDQ
CPKAFNWKSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHACSDCGK
TFATSSGLKQHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFS
TTSSLNKHRRFCEGKNHFTAGGLFAQGMPLPGAPGLDKSALAMGHGSSGLADYFGASRHH
GGLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATSPVRQPAHAPVAGHGAELSKSPLLPPS
PGLQESRELLKALRKDGGAPGNQMPGSELHAQSSSSSTKQRNKQSDQSESSDLDDVSTPS
GSDLESTSGSELESDMDSERERGAARENGKGPKRKASEGGPQSPSLTGSSAAKDFPGPSL
IPSSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGSLPYPSMFPLPFFPAF
SPPVYPFPDRDLRPPGLKGEPQSPADDCKKAQGKSSSESPFDLTTKRKEEKSATFAPSKP
QASQSTGQDQPLDLSLGTRGRGRNPREEDTKNNLGYEEEKTVVEIPKADTSLQHARPTPF
FMDPIYRVEKRRMSDPFETLKDKYMRPAPGFLFHPQFRLPDQRTWMSAIENMAEKLETFG
SLKPESGDLLRSVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTH
TGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENG
NLSGTAMSSPQSELDSGSAILDDKEDSYFNEIRNFISNTGQNQTSPDPSEEGLNGGPFEE
EKPLMASRGSRDLEDEEAEELGADEEEVEEPSNTPGKPEGDVLPSSLSDDIQDEMDFNEP
NDLNLTCKTSPRRYKDEEEQSGYSALDHIRHFSEMRKLEESELSDGDEDDGSFGSPSLTE
AVKQPLFRKSKSQAYAMMLSLAEKDSLHPASHNPATMWHSLARAAAESSAIQSLSHV
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacgagtgatggtgatgatgagtttgcc
ctttacccgtccgacatcttagatgatgtatgtggctctggtgatcctgcgccttcttcg
accctggcagaggacccagcatcccctccactctctgatgatgaggcttcaccccaggat
cccttgttgttccaacagcagagcatctttttaccccaagaagatttgaccattcccctg
gactttgaactgcgagagtcagcagttccaggcggaggcctgggcatctggagccgcagg
agggtaaacatcggggagcgctttggaccatatgaaggagagcacaggccttgtcttcga
gaccccgctcaaggctgggagatcttggacgggtcaggccatgtaaaattctgtgtggat
gccagcaagccagatatcgggagctggctgaagcatatccagtttgcccctgcggccaag
cagcataacctgacagcgtgccagatagatgatcagatcttctacaaagtcaccagagag
attttccccggtgaagagctgctacttttcatgaaggctgaagagtattcatgtgacacc
atggctcctgatattcatgaggagaggcagtaccgctgtgaggactgtgaccagcacttt
gagtcccgcaaccagctgctggaccaccagaagcagccgtgtgggatgcccccctcctcc
ttccttaacccaggaggggacagcgacctgaaggcccaggaacctcaagacctgcgaccc
cttcacgtgtcccacggtttacacgagtgtaaggagtgtgaccaggtgttccctgacatc
cagagtctggaggcccacactctgtcccactccgaagaaagggaatataagtgtgaccag
tgtcccaaggccttcaactggaaatctaacctgatccgacatcagatgtcgcacgacagt
ggcaagcactacgaatgtgaaaactgctcaaaggtgttcacagaccccagtaacctgcag
aggcacatccgctcacagcacgtcggggcgcgggcccacgcctgctctgactgcggcaag
acgtttgcaacgtcttcgggcctcaagcagcataagcacattcacagcagtgtcaagccc
ttcatgtgcgaggtgtgccacaagtcctacacccagttctctaacctgtgccgtcacaaa
cgcatgcacgctgactgccgcacacagatcaagtgcaaggactgtgggcagatgttcagc
accacatcctccctcaacaagcaccggcgcttctgtgaagggaaaaaccatttcacagca
gggggattgtttgcccagggtatgccactccctggcgcccctggcttggacaaatcagct
ctggcaatgggccacggcagttctgggctggctgattactttggggccagtcgccaccat
ggcgggcttacattccctgctgccccagcatttccattcagctttcctggcctcttcccc
tctggactctaccaccggccacctctcattcctgccacctctcctgtcagacaaccagcc
catgcacctgttgctgggcacggtgcagagctgagtaagagtccactgctgcctccaagc
cctggacttcaggagtcccgagaactactcaaggctctccgtaaagatggcggtgcacct
ggcaaccagatgccaggttcagagctccacgcccagagctcctcatcctccacgaagcag
cggaacaagcagagtgaccagtctgagagcagcgacctggacgatgtcagcacgcccagc
ggaagtgatcttgagagcacatcgggctccgagctagagagtgacatggacagtgagagg
gagaggggagctgctcgagaaaatggcaaaggtcccaagaggaaggccagtgaaggagga
ccccagagccccagcctgacaggcagcagtgctgccaaagactttccgggcccttccctc
atcccatcctcgctggacgagcacacagctgtaacaggggctgtaaatgactctattaag
gccattgcctccattgctgagaagtactttggctccacagggctggctggcctgcaggac
aagaaggtcgggtccctgccctatccgtccatgttcccactgcctttcttcccagctttc
tctcctccagtttacccttttccagacagggacctcagacctccaggcctgaagggcgag
ccacagtctccagcagatgactgcaagaaggcccagggcaaatcttcatccgaatcacca
tttgacctcactactaagcgaaaggaggagaagtctgccacattcgctccttccaaacca
caggcctcccagtccacaggtcaggatcagccgctagatctgagcctggggactaggggc
cgtggacgcaatccaagagaggaggacacgaagaataatctggggtatgaggaggagaaa
acagtggtggagatcccaaaagctgatacttcgttacagcatgccaggcccactcctttc
tttatggaccccatctacagggttgagaagaggagaatgagcgatccgtttgagactcta
aaggacaagtacatgcgaccagctccaggattcctcttccatccacagtttcgtttgcca
gatcagagaacttggatgtcggccatcgagaacatggcagagaagctggagacctttggc
tccttgaagccagagtctggtgacctgctgcgctccgtcccttccatgtttgacttcaga
gcaccgccctctgcacttccagagacgctgctgcgcaagggcaaggagcgctacacatgc
agatactgcgggaaaatattcccccgctctgctaacctgacccgccacctcaggactcat
acaggagagcaaccatacaggtgtaaatactgcgaccgctccttcagcatctcctccaac
ttgcaacgtcacatccgcaacatccacaacaaggaaaagcccttcaagtgccacttgtgt
gaccgttgcttcggtcagcagactaacctggatcgtcacctcaagaagcacgagaacggc
aacctttcaggcactgcaatgtcgtccccgcagtctgaactggacagtggcagtgccata
ttggatgacaaggaagactcttacttcaatgaaataagaaatttcatcagcaacacaggc
cagaaccagacatcaccggacccctctgaggaagggttaaacggcggcccgtttgaagaa
gagaagccgctgatggccagccgtgggtcacgtgacctggaagatgaagaagcggaggag
ctcggtgctgatgaagaagaagtggaagagcccagcaacacccccgggaaaccggaaggc
gatgtgcttcctagcagcctcagtgatgacatacaagacgaaatggacttcaacgagccg
aacgacttaaacctcacctgcaaaacctctcccaggagatataaggacgaggaggagcag
agcggctactcagccttggaccacattcgtcacttttcggaaatgcgcaagctggaggag
agtgagctgagtgacggagacgaggacgatggatcatttggctctccctctctgactgag
gccgtcaaacagccgctctttaggaaatctaagtctcaggcgtatgccatgatgctgtct
ctggctgaaaaggactctctccacccagcctcccacaacccagccaccatgtggcacagt
ctggcacgggctgctgctgaatccagtgccattcagtccctaagccatgtatga

DBGET integrated database retrieval system