KEGG   Lysobacter gummosus: LG3211_0093Help
Entry
LG3211_0093       CDS       T04163                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lgu  Lysobacter gummosus
Pathway
lgu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    LG3211_0093 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lgu03400]
    LG3211_0093 (recD)
Enzymes [BR:lgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LG3211_0093 (recD)
DNA repair and recombination proteins [BR:lgu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LG3211_0093 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD UvrD-helicase UvrD_C SH3_13 AAA_22 AAA_28 DUF2075 Herpes_Helicase T2SSE DEAD NTPase_1
Motif
Other DBs
NCBI-ProteinID: ALN89083
UniProt: A0A0S2FZV5
Position
92232..94067
Genome map
AA seq 611 aa AA seqDB search
MSLLDSLYREGALRTVDHALAQSLRRLDRDTPDRVLAAAALASQAIARGHAAFDPRRPQL
LTEAAIEWPDGDQWLAALADSRWIATPQADRPADPAAPLVLERGLLYLRRYREYERRLAQ
GLRRIAAFAPAPADLPALAPLFAALFPDARDDDRQARAAALALLQSLLLATGGPGTGKTT
TIARLLVLLIAQARLDGVPPPRIALAAPTGRAAERMAESLRAAAERLCTLDAVEASLCDA
LPRQASTLHRLLGSVPDSPRFRHDARNPLAFDVIVVDEASMVDLPLMCKLVEAVPDGVRL
ILLGDRDQLPSVEAGDVLAAIVDAAGDDDGLPAEWAVQLRPLLGEDTPVQHAAQPLSAYR
VHLRRGYRQAESLDLAPLAEATRAGDADTALELLRGGVLAGVHFHEDLHDPLAGGGRERL
LSAWREIGATDDPAQALALAAKLRLLTAMRDGGQGAAPLNARIEEALAGSHRPAYFHGRL
LLVTENSYRHGLFNGDIGVCLRPRGDEHAGAATVAWFAGGSDGVRGFHPSALPAHGGAFA
MTVHKAQGSEFDSVWLQLPRQDARHLSRELIYTGLTRARRELHIAASEAVLRLALSRHAA
RVSGLSWRLGA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgacagcctctaccgcgaaggcgcgctgcgcacggtcgatcacgccctg
gcgcagtccttgcgccggctcgatcgcgacacgcccgatcgcgtgctcgccgcggcggcg
ctggcttcgcaggcgatcgcgcgcggccacgccgcgttcgatccgcgccgcccgcagttg
ctgaccgaagcggcgatcgaatggcccgatggcgatcaatggctggcggcgctggccgat
tcgcgctggatcgcgacgccgcaggccgaccgtccggccgatccggcggcgccgttggtg
ctcgaacgcgggctgctgtatctgcgtcgttatcgcgaatacgaacgccgcctggcgcaa
ggcctgcgccgcatcgccgcgttcgcgccggcgccggccgatctgcctgcgctggcgccg
ctgttcgcggccttgtttcccgatgcgcgcgacgacgaccgccaggcgcgcgcggcggcg
ttggcgctgctgcagtcgctgctgctcgccaccggcggccccggcaccggcaagaccacc
accatcgcgcgattgctggtgctgttgatcgcgcaagcgcgcctggacggcgtgccgccg
ccgcgcatcgccctggccgcgccgaccggccgcgccgccgagcgcatggccgaaagcctg
cgcgcggcggccgaacgcctgtgcacgctcgacgcggtcgaggcctcgctgtgcgatgcc
ttgccgcgacaggccagcaccctgcaccgcttgctcggcagcgtgccggacagcccgcgg
ttccgtcacgacgcgcgcaatccgctggccttcgatgtgatcgtggtcgatgaggcctcg
atggtcgatctgccgctgatgtgcaagctggtcgaggccgtgcccgatggcgtgcggctg
attctgctcggcgatcgcgatcagctgccgtcggtggaagccggcgatgtgctcgcggcg
atcgtcgatgcggccggcgacgacgacggcttgccggcggagtgggccgtgcaactgcgg
cccttgctcggcgaggacacgccggtccagcacgcggcgcagccgctgagcgcgtatcgc
gtgcatctgcgtcgcggctatcgtcaggccgagagcctggacctggcgccgctggccgag
gccacgcgtgccggcgacgccgacaccgcgctcgaactgctgcgcggcggcgttttggcc
ggcgtgcatttccacgaagacctgcacgatccgctggccggcggcgggcgcgagcgcctg
ttgtcggcgtggcgcgaaatcggcgcgaccgacgatccggcgcaggcgctggccctggcg
gcgaagctgcgtctgctgacagcgatgcgcgacggcggccagggcgccgcgcccttgaac
gcgcggatcgaggaagcattggccggcagccatcgcccggcgtatttccacggccgtctg
ttgctggtgaccgagaacagctatcgccacggcctgttcaacggcgacatcggcgtgtgt
ttgcggccgcgcggcgacgaacatgcgggcgcggcgacggtggcgtggttcgccggtggc
agcgacggcgtgcgcggcttccatccctcggccttgcccgcgcacggcggcgcgttcgcg
atgaccgtgcacaaggcgcagggctcggaattcgacagcgtgtggctgcaactgccgcgt
caggacgcacggcacttgtcgcgcgaactgatctacaccggcctgacccgggcgcggcgt
gagttgcatatcgccgccagcgaagcggtgctgcggctggcgttgtcgcggcacgcggcg
cgcgtgtcggggttgtcgtggcggttgggggcgtag

DBGET integrated database retrieval system