KEGG   Manis javanica (Malayan pangolin): 108404714
Entry
108404714         CDS       T06054                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv05200  Pathways in cancer
mjv05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108404714
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404714
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    108404714
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108404714
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    108404714
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 108404714
NCBI-ProteinID: XP_017527930
Position
Unknown
AA seq 1050 aa
MKSEDYPHDTMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQ
KLESENDLREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSK
HPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSP
SEVKKLPKGSSESPFDLTTKRKDEKPLTPVPSKPPATSATSQDQPLDLSMGSRSRASGTK
LTEPRKNHVFGEKKGSSVETRPSSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKY
LRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPN
ALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELENTGAILDDK
EDAYFTEIRNFIGNSNHSSQSPRNTEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLL
DEEDEDNDITGKTGKEPVTSNIHEGNPEEDYEDSALEMSCKTSPVRYKEEEYKTGLSALD
HIRHFTDSLKMRKMEDNQYPEAELSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESL
HSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgaagagtgaagactatccccatgacactatggcgccggatatccatgaagaacggcag
tatcgctgtgaagactgtgaccagctctttgagtccaaggcagaactagcagatcaccaa
aagttcccgtgcagtacccctcactcagcattctcaatggtggaagaggactttcaacaa
aaacttgaaagtgaaaatgatctccgagagatacatgcaatccaggagtgcaaggaatgt
gaccaagtttttcctgacttgcaaagcctggagaaacatatgttgtcacacactgaagag
agggaatacaagtgtgaccagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaagcaggtt
ttcacggaccctagcaaccttcagcggcacattcgctctcagcacgttggtgcccgggct
catgcttgcccggagtgtggcaagacgtttgccacttcgtcgggcctcaaacaacacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgct
gactattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccccggtctgtttccttccggcttgtaccacaggcctcctttgatacct
gctagttctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagccacacaggatattttgaaggcactatctaaa
cacccacctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagag
aggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtact
ccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcag
aatctggcttcaatacataataagaaagaatacagcaatcattccattttctcaccatct
ttagaggagcaaactgccgtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcagtcaatg
tacccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaatcacca
agtgaagtaaagaaactgccgaagggaagctctgagtctccctttgatctcaccactaag
cgaaaggacgagaagcccttgactcctgtaccctccaaacctccagcaacatctgccaca
agccaggaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaag
ctgacggagcctcggaaaaaccacgtgtttggggaaaagaaaggaagcagtgttgaaacc
agaccgtcctcagatggttccttgcaacacgcgagacccactcctttctttatggaccct
atttacagagtagagaaaagaaaactaactgaccctcttgaggctttaaaagagaaatac
ttgagaccttctccaggattcttatttcatccacaattccaactgcctgatcagagaact
tggatgtcagctattgaaaacatggcagagaagctagagagcttcagtgccctgaaacca
gaggccagtgaacttctgcagtcagtgccctccatgtttaacttcagagcgcctcccaac
gccctgccagagaacctccttcggaaagggaaagagcgttatacttgcagatactgtggc
aagatttttcccaggtctgcaaacctgacacggcacttgagaacccacacaggggagcag
ccttacagatgcaaatactgtgacagatcattcagcatatcttctaacttacagcggcat
gttcgcaacatccacaataaggagaaaccctttaagtgtcacttatgcgataggtgtttc
ggtcaacaaaccaatttagacagacacctaaagaaacatgagaatgggaacatgtctggt
acggcaacatcgtcgcctcattctgaactagaaaacactggtgcgattcttgatgacaaa
gaagatgcttacttcacagaaattcgaaacttcattgggaatagcaatcacagcagccag
tctcccagaaacacggaggagagaatgaatggcagtcattttaaggatgaaaaagctttg
gtgactagtcaaaattcagatttactggatgatgaagaagtagaagatgaggtgttgtta
gatgaggaggatgaagacaacgatattactggaaaaacaggaaaagaaccagtgaccagt
aatatacatgaaggaaaccctgaggaggactatgaagatagcgccctggagatgagttgc
aagacgtccccagtgaggtataaagaggaagaatataaaactggactttctgctctagat
cacataaggcacttcacagatagcctcaaaatgaggaaaatggaagataatcaatatcct
gaagctgagctgtcttttagtacttcccatgtgccggaggaacttaaacagccgttacac
agaaagtccaaatcacaggcatatgctatgatgctgtcattgtctgacaaggagtccctc
cattctacatcccacagttcttctaatgtgtggcacagtatggcaagggctgcggcggaa
tccagcgccatccagtccataagccatgtatga

DBGET integrated database retrieval system