KEGG   Mesorhizobium japonicum MAFF 303099: mlr6400
Entry
mlr6400           CDS       T00043                                 
Name
(GenBank) conjugal transfer protein; TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    mlr6400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr6400
Enzymes [BR:mlo01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     mlr6400
Secretion system [BR:mlo02044]
 Type IV secretion system
  Trb secretion system protein
   mlr6400
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 AAA_22 ABC_tran TraG-D_C DUF87 AAA_29 nSTAND3 FtsK_SpoIIIE AAA_16 AAA_7 ResIII
Other DBs
NCBI-ProteinID: BAB52704
RhizoBase: mlr6400
UniProt: Q989J2
Position
5222139..5224589
AA seq 816 aa
MLNLSEYRGKADRLADHLPWAALVAPGIVLNKDGSVQRTLRFRGPDLESSTEAELLGICA
RANNALRRLGSGWTLFFEAERIEALGYPSSRFPDAASWLVDEERRAAFEGKVAHFESRCH
LTLLSMPPPDAQARAESALVDSHHSEGERDWRQEMARFRDETDRVLDLLSGFMPEVRPLD
DAETLTYLHDTISTRRHPVAVPETPMYLDGILVDVPLTGGLEPMLGEQHLRTLTILGFPN
LTRPGILDALNHQDFAYRWMTRFIPLDKTEATKTLTRLRRQWFAKRKSIVAILREVVSNE
PVPLVDSDADNKALDADEALQALGGDHVGFGYLTATVTVWDEDRQAAAEKLRAVERIING
LGFTTIRESVNAVEAWLGSLPGHVYANVRQPLVHTLNLAHLMPLSSVWAGPAANEHLAEV
TGREAPPLLIAETSGSTPFRLSSHVEDVGHMLIVGPTGAGKSVLLALIALQFRRYAGAQV
YVFDKGNSARAATLAMGGEHHVLGSDGALAFQPLRNIGDQGRRSWAAEWIAGLIAHENVT
LTPEVKEAIWSALNSLATAPAQERTLTGLSVLLQSNALKSALMPYTLDGPFGRLLDADDD
RLALSDVQCFETEELMHSQSAVLPVLTYLFHRLEERFDGRPTLLMLDEAWVYLDNPLFAA
RIREWLKVLRKKNVSVIFATQSLADIAGSAIAPAIIESCPQRIFLPNDRAVEPQARTAYE
RFGLNDRQIELIARATPKRHYYLQSRCGNRLFELGLGPIALALCGASGPAAQSLIDRVLS
KHGQDSFVFRFLGARGLDWAAELLQQFPQPTKEQSP
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgctgaacctttcggaatatcgcggcaaggccgaccggcttgccgaccatctgccctgg
gcagcactggtggcgcccggcatcgtgctcaacaaggacggcagcgttcagcggactctt
cgatttcgcgggcccgatctggaaagctcgaccgaagccgaactcctcggcatctgcgcc
cgggccaacaatgcgcttagacgccttggctccggctggacattgtttttcgaggccgag
cgcatcgaagcgctgggctatccgtcctcgcgtttcccggacgcggcgtcatggctggtt
gatgaagaacggcgtgctgccttcgaaggcaaggtcgcgcatttcgagagccgctgtcac
ctgaccttgctgtccatgccgccaccggacgcccaggcgcgggcggaaagcgcgctcgtc
gactcgcatcattcagaaggcgaaagagactggcgccaggagatggcgcggttccgtgac
gagaccgaccgtgtgctggatcttctgtcgggcttcatgcccgaagtgcgtccgctcgat
gacgccgagacgctgacatacctgcacgacacgatctcgacccgccgccatccggtcgcc
gtgccggaaacgccaatgtatctggacggcatcctggtcgatgtgccgcttaccggcggc
ttggagccgatgctcggtgagcaacatcttcgcacccttaccatcctcggctttccgaac
ctcacccggcccggaatcctcgatgccctcaatcatcaggatttcgcctatcgctggatg
acgcgcttcattccgctcgacaagaccgaggccaccaagacgctgacccgcttgcgccgg
cagtggtttgccaagcgcaaatcgatcgtcgcaatcctgcgcgaggttgtaagcaacgaa
cccgttccgctcgtcgacagcgacgccgacaataaggcgctcgacgccgatgaagcactt
caggcgttgggcggcgatcatgtcggcttcgggtatctcactgcaacggtgacggtatgg
gacgaggatcgccaagccgccgctgagaaacttcgcgcggtcgagcgcatcatcaatggg
ctcgggttcaccaccatccgcgaaagcgtcaatgcggtcgaagcctggctcggctcgctg
ccgggtcatgtctatgccaacgttcgtcagccgctcgttcacacgctgaaccttgcccat
ctcatgccgctttcctcggtgtgggccggtcctgcggcgaacgagcatctggctgaagtc
actggacgagaggccccgccgctcctcatcgccgaaaccagcgggtcgactccgttccgg
ctttcttcccatgtcgaagatgtcggccacatgctgatcgttggaccgaccggcgccgga
aaatcggtgctgcttgccctgatcgccctgcagtttcgtcgctatgccggcgcgcaggtc
tatgtcttcgacaaaggcaattcggcgcgcgcggcaacgctcgccatgggtggagagcat
catgtcttgggttcggacggtgcgcttgccttccagccactgcgcaatatcggtgatcag
ggtaggcgcagctgggcagctgaatggatcgccggcctgattgcccatgagaacgtcacc
ctcacgccggaggtgaaggaggcgatctggtcggcgctcaacagcctcgccaccgcgccg
gcgcaggagcgcacgctgaccggtctgtcggtcctgcttcagtccaatgcactgaagtcc
gccttaatgccctacacgctcgacggtcccttcggccgattgctcgatgccgacgacgat
cggctggccttgtcggatgtgcagtgcttcgagaccgaggagctgatgcatagccaaagc
gctgtgctgcctgtgctcacctatctcttccatcgccttgaggagcggttcgacgggcga
ccgacgctgctcatgctcgatgaggcctgggtctatctcgacaatccgctttttgctgcc
cgcatccgcgaatggctgaaggtgctgcgaaagaagaacgtatcggtgatcttcgccacg
cagtcgcttgccgacatcgccggctctgcaatagcgccggcgatcatcgagagctgccca
cagcgcatttttctccccaatgatcgtgccgtggaaccgcaggcacggactgcctacgag
cgcttcggtctcaacgaccggcagattgaactgatcgcccgggccacgccgaagcggcac
tactatttgcagtcgcgctgcggcaaccgtctcttcgagctcgggctcggccccatcgcg
cttgcactttgcggcgcctcgggtccagccgcgcaaagcctgatcgacagggtcctgtcc
aagcacgggcaggacagctttgtctttcgcttcctcggcgcccgcggcctggattgggcg
gccgagcttctccagcaattccctcaaccaaccaaggagcaatcgccatga

DBGET integrated database retrieval system