KEGG   Methylomonas methanica: Metme_2014
Entry
Metme_2014        CDS       T01511                                 

Definition
(GenBank) conjugative coupling factor TraD, SXT/TOL subfamily
Organism
mmt  Methylomonas methanica
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C DUF87 T4SS-DNA_transf FtsK_SpoIIIE AAA_10
Other DBs
NCBI-ProteinID: AEG00424
UniProt: G0A594
Position
2209094..2211148
AA seq 684 aa
MKSQYPVEALLRPPVELWSAVCAFACALLAGLAPWAIMMTPSVGYATAGLLTLLGLARTR
QALFVLRYQRNMRKLPRYEIAAQDIPVSRQRLFLGKGFLWQQKHTQRLRDTLHPKVRRYI
EPSFAYQLARRLERRWESSPTLQPLTKLMQSPAWWNPVAPLPPVGGKPQIHAVELEEQPV
SMDLRERVGHTLVLGTTRVGKTRLAELLITQDIARGDTVIVFDPKGDADLMKRMVAEAKR
AGRSRHLYLFHLGYPEISSRYNAIGNFSRITEVATRLTNPLPSTGNSAAFREFAWRFTNM
IAVALVKMGKRPDYKLITRYITHIEPLLTEYYRQWLPDVAPPDWEQQVQRIAASINERDL
PFALKGRSPEVIALVRYVKDNGFYDAVADGLRSAFEYDKTYFDKIVASLLPLMEKLITGK
TAALISPDYTDIADTRPIIDWRQIIRRQGIVYVGLDALSDMAVASAVGNSMFADLVSVSG
EIYKHGTDHGLPDAVKTHELPTISLHADEFNELIGDEFIPLLNKAGGSGFQVTAYTQTWS
DVEARIGNKAKAGQVAGNFNTLIMLRVKELATAEMLTNQIDTCNISTLMEVSGVNDSADP
NSPIDFTSQNQDRISVTEMPMISPATVMALPKGQAFALLEGGNLWKIRIPLPTKANDALL
PKNLQEVAHEMQRRYLTNDHWWAG
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgaagtcccagtatccggtcgaagccttgctgcggccgccggtcgaactgtggtcggcg
gtttgtgccttcgcttgtgcgttgctggccggcctggcgccgtgggctatcatgatgacg
ccatcggtgggttatgccacggctggcttattgacgctgctcggtttggctagaacccgg
caagcgttattcgtcttgcgctatcaacgcaacatgcgcaagctgccacgttatgaaatc
gcagcccaagacattccggtcagccgccagcgtttgtttttgggtaaaggctttttgtgg
cagcaaaaacacacccaacggttgcgcgataccttgcatcctaaggtgcggcgctatatc
gaaccgtcctttgcctatcaactggcccggcgtttggagcgccgctgggaatcatcgcca
acgttgcagccgttgaccaaactgatgcaaagcccagcctggtggaacccggtcgcgccg
ttaccgccggtcggcggcaaaccgcagattcatgcggtggaactcgaagaacagccggtc
agtatggatttgcgcgaacgggtcgggcataccctggtgctgggcactacccgggtcggc
aaaacccggctggccgaactcttgatcacgcaggatatcgcccgcggcgataccgtgatc
gtgttcgatccgaaaggcgatgccgatctgatgaaacgcatggtcgcagaagccaaacgc
gccggtcgcagtcggcatctgtatctcttccatctgggctatccggagatttccagccgc
tataacgccatcggcaatttctcccgcatcaccgaagtcgccacccgcttgaccaacccc
ttgcccagcactggcaattcggcggcgttccgtgaattcgcctggcgctttaccaatatg
atcgccgtggcgctggtcaaaatgggcaaacgcccggattataaattgatcacccgctac
atcacccatatcgagccactgttgaccgaatactaccggcaatggctgcccgacgtggcg
ccgccggactgggaacaacaggtacagcgcatagccgcttccatcaacgaacgcgattta
ccctttgcgctaaaaggccgatcgccggaagtgattgccctggtacgctatgtcaaagac
aatggcttttacgatgccgtcgccgatggcctgcggtcggcgttcgaatacgacaagacc
tatttcgataaaatcgtcgcatccttattgccgttgatggaaaaactgattaccggcaaa
accgcggcgctgatctcgccggactacaccgacatcgccgacactcggcccatcatcgac
tggcggcaaatcattcgccgtcaaggcatcgtctatgtcgggctggatgccttatcggat
atggcggtagcatccgcagtcggcaattccatgtttgccgatctggtctccgtttccggc
gaaatctacaaacacggcaccgaccacggtctgccggatgcggtaaaaacccatgagctg
ccgacgatttccttgcatgccgacgaattcaacgaattgatcggcgacgagtttattccc
ttgctcaacaaggccggcggctcggggtttcaagtcacggcctatacccaaacctggtcg
gatgtggaagcccgcatcggcaacaaggccaaagccgggcaggtggccggcaacttcaat
accctgatcatgctgcgggtcaaagaactggccaccgccgaaatgctcaccaaccaaatc
gacacctgtaacatcagcacgctgatggaagtatccggcgtcaacgattcggccgatccc
aattcccccatcgattttacctcgcaaaaccaggaccgcatttccgtcaccgaaatgccg
atgatttcaccggccaccgtgatggccttacccaaaggccaggccttcgccttgctggaa
ggcggcaatctgtggaaaattcgcatcccgttgccaactaaagccaacgatgcgctgttg
ccgaaaaacctgcaggaggtggcccatgaaatgcagcgccgctatctgaccaacgaccac
tggtgggcaggctga

DBGET integrated database retrieval system