KEGG   Mus musculus (mouse): 11891Help
Entry
11891             CDS       T01002                                 

Gene name
Rab27a, 2210402C08Rik, 2410003M20Rik, 4933437C11Rik, ash
Definition
(RefSeq) RAB27A, member RAS oncogene family
  KO
K07885  Ras-related protein Rab-27A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11891 (Rab27a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    11891 (Rab27a)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    11891 (Rab27a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    11891 (Rab27a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 TPP_enzyme_M DUF5040 Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 11891
NCBI-ProteinID: NP_001288159
MGI: 1861441
Ensembl: ENSMUSG00000032202
Vega: OTTMUSG00000044792
UniProt: Q9ERI2 Q544U7
Structure
PDB: 

Position
9 D; 9 40.08 cM
AA seq 221 aa AA seqDB search
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDG
AVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMH
AYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDL
IMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatggagattacgattacctcatcaagttcttggccttgggagactctggggta
gggaagaccagtgtactctaccagtacactgatggcaagttcaactccaaattcatcacc
acagtgggcattgatttcagggaaaagagagtggtgtacagagccaatgggccagatgga
gctgtgggccgaggccagagaatccacctgcagttatgggacacggcggggcaggagagg
tttcgtagcttaaccactgcattcttcagggacgctatgggtttcctgcttctgttcgac
ctgacaaatgagcaaagtttcctcaatgtccgaaactggataagccagctacagatgcac
gcgtactgtgaaaacccagatatagtgctgtgtggaaataagagtgacctggaagaccag
agggcagtgaaagaggaggaggcccgggaacttgccgagaagtacggaatcccctatttt
gaaaccagtgctgccaacgggacaaacataagccacgcgattgagatgctcctggacctg
atcatgaagcggatggagcggtgtgtggacaagtcctggattccggagggagtggtacgg
tccaacggccatacctctgcggatcagctaagtgaggagaaggagaaggggttgtgtggc
tgttga

DBGET integrated database retrieval system