KEGG   Mus musculus (mouse): 12032
Entry
12032             CDS       T01002                                 

Gene name
Bcan, Csp, Cspg7
Definition
(RefSeq) brevican
  KO
K06795  brevican
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12032 (Bcan)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12032 (Bcan)
   04091 Lectins [BR:mmu04091]
    12032 (Bcan)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   12032 (Bcan)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   12032 (Bcan)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   12032 (Bcan)
Motif
Pfam: Xlink Lectin_C V-set EGF Sushi hEGF I-set EGF_2 Izumo-Ig ig Ig_2 EGF_3 Ig_3 EGF_CA
Other DBs
NCBI-GeneID: 12032
NCBI-ProteinID: NP_031555
MGI: 1096385
Ensembl: ENSMUSG00000004892
Vega: OTTMUSG00000051892
UniProt: Q61361
Position
3 F1; 3 38.78 cM
AA seq 883 aa
MIPLLLSLLAALVLTQAPAALADDLKEDSSEDRAFRVRIGATQLRGVLGGALAIPCHVHH
LRPPHSRRAAPGFPRVKWTFLSGDREVEVLVARGLRVKVNEAYRFRVALPAYPASLTDVS
LVLSELRPNDSGVYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACAR
IGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQNPREACSGDMDGYPGVRNYGVVG
PDDLYDVYCYAEDLNGELFLGAPPSKLTWEEARDYCLERGAQIASTGQLYAAWNGGLDRC
SPGWLADGSVRYPIITPSQRCGGGLPGVKTLFLFPNQTGFPSKQNRFNVYCFRDSAHPSA
SSEASSPASDGLEAIVTVTEKLEELQLPQEAMESESRGAIYSIPISEDGGGGSSTPEDPA
EAPRTPLESETQSIAPPTESSEEEGVALEEEERFKDLEALEEEKEQEDLWVWPRELSSPL
PTGSETEHSLSQVSPPAQAVLQLGASPSPGPPRVRGPPAETLLPPREGSPTSTPGGAREV
GGETGSPELSGVPRESEEAGSSSLEDGPSLLPATWAPVGPRELETPSEEKSGRTVLAGTS
VQAQPVLPTDSASHGGVAVAPSSGDCIPSPCHNGGTCLEEKEGFRCLCLPGYGGDLCDVG
LHFCSPGWEAFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQW
IGLNDRTIEGDFLWSDGAPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHL
SYTCKMGLVSCGPPPQLPLAQIFGRPRLRYAVDTVLRYRCRDGLAQRNLPLIRCQENGLW
EAPQISCVPRRPGRALRSMDAPEGPRGQLSRHRKAPLTPPSSL
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgattccactgcttctgtccctgctggccgctctggtcctgacccaagcccctgccgcc
ctcgctgatgacctgaaagaagacagctcggaggatcgagccttccgcgtgcgcatcggt
gccacgcagctgcggggcgtgctgggcggtgccctggccatcccatgccacgtccaccac
ctgcggccgccgcacagtcgccgggccgcgccgggttttccccgggtcaagtggaccttc
ctgtccggggaccgggaggtagaggtactggtggctcgtgggctgcgcgtcaaggtaaac
gaagcctaccggttccgcgtggcgctgcctgcctaccccgcatcgctcacggatgtgtct
ctagtattgagcgaactgcggcccaatgattccggggtctatcgctgcgaggtccagcac
ggtatcgacgacagcagtgatgctgtggaggtcaaggtcaaaggggtcgtcttcctctac
agagagggctctgcgcgctatgctttctcctttgctggagcccaggaagcctgcgctcgc
ataggagcccgaatcgccaccccggagcagctctatgctgcctacctcggcggctatgag
cagtgtgatgcaggctggctgtccgaccaaactgtgaggtaccccatccagaacccacga
gaggcctgctctggagacatggatggctatcctggcgtgcggaactacggagtggtgggt
cctgatgatctctatgatgtctactgttatgccgaagacctaaatggagaactgttccta
ggcgcccctcccagcaagctgacatgggaggaggctcgggactactgtctggaacgtggt
gcacagatcgctagcacaggccagctgtacgcagcctggaatggtggcctggacagatgt
agccctggctggctggctgatggcagcgtgcgctatcccatcatcacacccagccaacgc
tgtgggggcggcctgccaggagtcaagaccctcttcctctttcccaaccagactggcttc
cccagcaagcagaaccgcttcaatgtctactgcttccgagactctgcccatccctctgct
tcctctgaggcctctagcccagcctcagatggacttgaggccattgtcacagtgacagaa
aagctggaggaactgcagctgcctcaggaagcgatggagagcgagtctcgtggggccatc
tactccatccccatctcagaagatgggggaggaggaagctccaccccagaagacccagca
gaggcccccaggactccgctagaatcggaaacccaatccattgcaccacctaccgagtcc
tcagaagaggaaggcgtagccctggaggaagaagaaagattcaaagacttggaggctctg
gaggaagagaaggagcaggaggacctgtgggtgtggcccagagagctcagcagccctctc
cctactggctcagaaacagagcattcactctcccaggtgtccccaccagcccaggcagtt
ctacagctgggtgcctcaccttctcctgggcctccaagggtccgtggaccgcctgcagag
actttgctccccccgagggagggaagccccacatctactcctggtggggcaagagaagta
gggggggaaactgggagccctgagctctctggggttcctcgagagagcgaggaggcaggg
agctccagcttggaggatggcccttccctacttccagctacatgggcccctgtgggtccc
agggagctggagaccccctcagaagagaagtctggaagaactgtcctggcaggcacctca
gtgcaggcccagccagtgctgcccaccgacagtgccagccacggtggagtggctgtggct
ccctcatcaggtgactgtatccccagcccctgccacaatggtgggacatgcttggaggag
aaggagggtttccgctgcctatgtttgccaggctatgggggggacctgtgcgatgttggc
cttcatttctgcagccctggctgggaggccttccagggagcctgctacaagcacttttcc
acacgaaggagttgggaggaggcagaaagtcagtgccgagcgctaggtgctcatctgacc
agcatctgcacccctgaggagcaagactttgtcaacgatcgataccgggagtaccagtgg
attgggctcaatgacaggaccatcgagggtgacttcttgtggtcagatggtgcccctctg
ctctatgaaaactggaaccctgggcagcctgacagctacttcctgtctggggagaactgt
gtggtcatggtgtggcatgaccagggacagtggagtgatgtgccctgcaactaccatcta
tcctacacctgcaagatggggcttgtgtcctgtgggcctccaccacagctacccctggct
caaatatttggtcgccctcggctgcgctacgcggtggatactgtgcttcgatatcgatgc
cgagacgggctggctcagcgcaacctgccgttgatccgctgccaggagaatgggctttgg
gaggcccctcagatttcctgtgtaccccggaggcctggccgtgctctgcgctccatggac
gccccagaaggaccacggggacagctctcgaggcacaggaaggcaccgttgacaccgccc
tccagtctctag

DBGET integrated database retrieval system