KEGG   Mus musculus (mouse): 13497
Entry
13497             CDS       T01002                                 

Symbol
Drp2, AW495265, DRP-2
Name
(RefSeq) dystrophin related protein 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: EF-hand_2 EF-hand_3 ZZ Spectrin WW SOGA Miff HALZ
Other DBs
NCBI-GeneID: 13497
NCBI-ProteinID: NP_034208
MGI: 107432
Ensembl: ENSMUSG00000000223
Vega: OTTMUSG00000019226
UniProt: Q05AA6
Position
X:133304873..133357323
AA seq 957 aa
MQPLVMQGCPYTLPRCHEWHAADRFHHSSSLRNTCPQPQVRAAVTIPAPPWDGAGDPCLS
PKLLNGTVGATGPLEPSAMNLCWNEIKKKSHNLRARLEAFSDLSGKLQLPLREIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAAFMEEVKSKGPYISSVLESAQAFLSQHPFEELEE
SQSESKDTSPRQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIEHTLEHLLEIQGAM
EELSSTLTQAEGVRATWEPIGDLFIDSLPEHIQAIKLFKEEFSPVKDGVKLVNDLAHQLA
ISDVHLSMENSRALEQINIRWKQLQVSVAERLKQLQDAHRDFGPGSQHFLSTSVQVPWER
AISPNKVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDSGRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGALLHEAIQ
VPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTI
AEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPT
TSSENMRDFATTLKNKFRSKQYFSKHPQRGYLPVQSVLESDCSETPASSPMLPHADTHSR
IEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPAFGQQAPCSMATE
SKGELEKILAHLEDENRILQGELRRLKWQHEEAAEAPTLVEGSAEATPDHRNEELLAEAR
ILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPSESDGNGSAGSSLASSPRQSEG
SHPREKGQTTPDTEVADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgcaacctttggtcatgcagggatgcccttacaccctcccacgatgtcatgagtggcat
gctgctgaccggtttcatcacagcagcagcctccgaaacacctgtccccagcctcaggtt
agagctgcggtcaccatccctgctccaccttgggatggtgccggggatccctgcctaagt
ccaaagctcttgaacgggactgttggagccaccgggcccctggagccatcagccatgaat
ctgtgttggaatgaaataaaaaagaagtctcacaacctccgcgctcgcctagaggccttc
tcagacctcagtggaaaacttcagctcccgctccgagagattattgactggctcagccaa
aaggatgaggagttgtcagctcagctccccttgcaaggggatgtggccctggtacaacag
gagaaggagacacatgcagccttcatggaagaagtcaagtctaagggcccctacatctcc
tctgtgcttgaatccgcccaggcttttctgtcccagcatccatttgaagaattagaggag
tctcaatctgagagtaaagatacctcccccagacagcggattcaaaaccttagtcgcttt
gtatggaagcaggcaacagtggccagtgagctgtgggagaagctgacagcccgctgtgta
gatcagcatcgccacattgagcatactctggaacatctattggagatccaaggggcaatg
gaggaattgagcagtactttgacccaagcagagggagtccgagccacgtgggagcccata
ggagatctctttattgattccctcccagagcatatccaagccatcaagctattcaaagaa
gaattctctcctgtgaaagatggggtgaagttagtgaatgatctggcccaccagcttgcc
atctctgatgtgcacttgtcaatggagaattccagggctctggaacagatcaacatccgg
tggaaacagctccaggtgtcagtggctgagaggcttaagcaactccaggatgcccaccgg
gactttgggcctgggtcacagcacttcctctccacttctgtccaagttccctgggaaaga
gcaatttctcccaataaagtcccctactacatcaaccaccaggctcagaccacatgctgg
gaccatcctaagatgactgagttataccaaaccctagccgatctgaacaacattaagttc
tcagcttaccgcactgccatgaagctccgcagagtccagaaggccctgcgcctggatctg
gtaactttaactacagctctggagatcttcaatgagcatgacttgcaggccagtgaacat
gtgatggatgtggtggaggtcattcactgcttgactgccttgtatgaacgactggaggag
gaaagaggcatcctggtcaatgtgccactgtgtgtagacatgagcctcaactggctcctc
aatgtttttgatagtggtcgcagtggaaagatgcgagcattgtcctttaagactggcatc
gcatgcctgtgtggcacggaagtgaaagaaaaacttcagtatctcttcagccaagtagcc
aattcaggcagccagtgtgatcaacgccatctcggtgccctgcttcatgaagccattcaa
gtgccccgtcagctgggtgaagtggcagcatttgggggcagcaatgtggagcccagtgtc
cgtagctgctttcgctttagcactggcaagccagtcattgaagcttcccaattcctggag
tgggtcaacttggagccccagtctatggtgtggctggctgttctgcatcgggtcaccatc
gctgagcaagtgaagcatcaaaccaagtgctctatctgtagacagtgccccatcaaaggg
ttcaggtaccggagtctgaaacagtttaacgtggatatctgccagacctgcttcttgacc
ggcagggccagcaaaggcaacaagctccactatcccatcatggagtattacacaccgacc
acatctagtgaaaacatgagggactttgccacaaccttaaagaataaattccgctccaag
cagtatttcagcaaacaccctcagcgaggttatctgcccgtgcagtcagttctggagagc
gactgcagtgagacacctgcttcttccccgatgttgccacacgctgacacacactctcga
attgaacattttgccagcaggcttgctgagatggaaagtcaaaattgttccttttttaat
gacagcctgtccccggatgatagcatcgatgaggaccagtacctgttgcggcactccagc
cccatcacagaccgagagccggcctttggacagcaggctccatgcagcatggccacagaa
agcaagggggagctagagaagatcttggcccatttagaagatgagaaccggattctccag
ggagagctgaggcgcctgaaatggcagcacgaggaggcagccgaggcacctaccctggtt
gagggctctgctgaagccaccccagaccaccgcaatgaagaacttctggctgaagccagg
atcctgcggcagcacaaaagccgcctggagacgcgcatgcagatccttgaagaccacaac
aagcagctcgagtctcagctgcaacgcctgagggagctgctcctgcagccacccagtgaa
tcagatggcaatggctctgcaggctcctccctagcttcctctccacgccagtcagaaggc
agtcatccccgggagaagggacagactactccagacactgaggttgcagatgatgtgggg
tcaaagagtcaggatgtcagcctatgcttagaagacatcatggagaagctccgccatgcc
ttccccagtgtgcgaagctctgatgtgactgcaaacactctgctggcctcttga

DBGET integrated database retrieval system