KEGG   Mus musculus (house mouse): 14368
Entry
14368             CDS       T01002                                 
Symbol
Fzd6, Fz6, rst
Name
(RefSeq) frizzled class receptor 6
  KO
K02376  frizzled 6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14368 (Fzd6)
   04390 Hippo signaling pathway
    14368 (Fzd6)
   04150 mTOR signaling pathway
    14368 (Fzd6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14368 (Fzd6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14368 (Fzd6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14368 (Fzd6)
   05205 Proteoglycans in cancer
    14368 (Fzd6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14368 (Fzd6)
   05226 Gastric cancer
    14368 (Fzd6)
   05217 Basal cell carcinoma
    14368 (Fzd6)
   05224 Breast cancer
    14368 (Fzd6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14368 (Fzd6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    14368 (Fzd6)
   05022 Pathways of neurodegeneration - multiple diseases
    14368 (Fzd6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14368 (Fzd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14368 (Fzd6)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14368 (Fzd6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha Mid1 RseC_MucC
Other DBs
NCBI-GeneID: 14368
NCBI-ProteinID: NP_001155966
MGI: 108474
Ensembl: ENSMUSG00000022297
Position
15:38869673..38901587
AA seq 709 aa
MERSPFLLACILLPLVRGHSLFTCEPITVPRCMKMTYNMTFFPNLMGHYDQGIAAVEMGH
FLHLANLECSPNIEMFLCQAFIPTCTEQIHVVLPCRKLCEKIVSDCKKLMDTFGIRWPEE
LECNRLPHCDDTVPVTSHPHTELSGPQKKSDQVPRDIGFWCPKHLRTSGDQGYRFLGIEQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGDTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRITWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHGAPGPHRLKVISKSMGTSTGATTNHGTSAMAIADHDYLGQETSTEVHTSPEASVKEG
RADRANTPSAKDRDCGESAGPSSKLSGNRNGRESRAGGLKERSNGSEGAPSEGRVSPKSS
VPETGLIDCSTSQAASSPEPTSLKGSTSLPVHSASRARKEQGAGSHSDA
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggaaaggtccccgtttctgttggcgtgcattcttctgcccctcgtaagaggacacagc
cttttcacctgtgagccaatcaccgttcccagatgtatgaaaatgacttacaacatgacg
ttcttccctaacctgatgggtcattatgaccaggggatcgctgctgtggaaatggggcac
tttctgcatcttgcaaatctagaatgttcaccaaacattgaaatgttcctttgccaagct
tttataccaacctgcacagagcaaattcatgtagttctaccctgtcggaaattgtgtgag
aaaatagtttctgattgcaaaaaactaatggacacttttggcatccgatggcctgaagaa
cttgaatgtaacagattgccacactgtgatgacactgttcctgtaacttctcatccacac
acagagctttctgggccacagaagaaatcagatcaagtcccaagagacattggattttgg
tgtccaaagcaccttaggacttccggggaccaaggctataggtttctgggaattgaacag
tgtgcccctccgtgccccaatatgtattttaaaagtgatgaactagactttgccaaaagt
ttcataggaatagtttcaatattttgtctttgtgcaactctgttcacgttccttacattt
ttaattgacgttagacgattcagatacccagagagaccaattatctattactctgtctgc
tacagcattgtctctctcatgtacttcgtggggtttttgctgggcaatagcacggcttgt
aataaggcagacgagaagctggagctcggggacaccgttgtcctagggtcaaagaataag
gcttgcagtgtggtatttatgtttctgtatttttttacaatggctggcaccgtgtggtgg
gtgattctcaccattacgtggttcttagctgccgggagaaaatggagttgcgaagctatt
gaacaaaaagcagtgtggttccatgccgttgcctggggggcgcccgggttcctgaccgtc
atgctgctcgctatgaataaggttgaaggagacaacattagcggcgtttgcttcgttggc
ctgtatgacctggacgcctctcgctacttcgtccttctgcctctgtgcctctgcgtattt
gttgggctgtctctcctcttagccggcatcatctccttgaatcatgtccgacaagtcata
cagcatgatggccggaaccaagagaagctaaagaaattcatgattcgcatcggagtcttc
agtggcctgtatcttgtgcccttagtgacacttctcggttgctatgtctatgagctagtg
aacaggatcacctgggagatgacatggttctctgatcattgtcaccagtaccgcatcccg
tgcccttaccaggcaaatccaaaagctcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggtatctctgcggtcttctgggttggaagcaaaaagacgtgc
acagaatgggccgggttctttaagcgaaaccgcaagcgagaccccatcagtgagagccgc
cgagtgctgcaagagtcctgtgagttcttcctgaagcacaactctaaagtgaagcacaag
aagaagcatggcgcaccagggcctcataggctgaaggtcatttccaagtccatgggaact
agcacaggagcgaccacaaatcatggcacctctgccatggcaatcgctgaccatgattac
ttagggcaagaaacttcaacagaagtccacacctccccagaagcatccgtcaaagaggga
cgagcagaccgagcaaacactcccagcgccaaagatcgggactgtggggaatctgcaggg
cccagttccaagctctctgggaaccggaacggcagggaaagccgagcgggcggcctgaag
gagagaagcaatggatcagagggggctccaagtgaaggaagggtaagtccaaagagcagc
gttcctgagactggcctgatagactgcagcacttcacaggccgccagttctccagaacca
accagcctcaagggctccacatctctgcctgttcactcagcttccagagctaggaaagag
cagggtgctggcagccattccgacgcttga

DBGET integrated database retrieval system