KEGG   Mus musculus (house mouse): 14680
Entry
14680             CDS       T01002                                 
Symbol
Gnal, 2610011C15Rik, 9630020G10Rik, Galphaolf, Gna10, Golf, Hg1o
Name
(RefSeq) guanine nucleotide binding protein, alpha stimulating, olfactory type
  KO
K04633  guanine nucleotide-binding protein G(olf) subunit alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu05012  Parkinson disease
mmu05142  Chagas disease
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    14680 (Gnal)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    14680 (Gnal)
  09157 Sensory system
   04740 Olfactory transduction
    14680 (Gnal)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14680 (Gnal)
   05142 Chagas disease
    14680 (Gnal)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    14680 (Gnal)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    14680 (Gnal)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    14680 (Gnal)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA GTP_EFTU TniB AAA_29 AAA_14
Other DBs
NCBI-GeneID: 14680
NCBI-ProteinID: NP_034437
MGI: 95774
Ensembl: ENSMUSG00000024524
UniProt: Q8CGK7 Q3TY78
Position
18:67221369..67359863
AA seq 381 aa
MGCLGNSSKTAEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVK
QMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKS
IAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPT
DQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSY
NMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFP
EYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIR
RVFNDCRDIIQRMHLKQYELL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggggtgtttgggcaacagcagcaagaccgcggaagatcagggcgtagatgaaaaagaa
cgccgcgaggccaacaaaaagatcgagaagcagttgcagaaagagcgcctggcttacaaa
gcaactcaccgcctgctgcttctgggggctggtgagtccgggaaaagcactatcgtcaaa
cagatgaggatcctgcacgtcaatggcttcaaccccgaggaaaagaagcagaaaattctg
gacatcaggaaaaatgtcaaagatgcgatcgtgacaatcgtttcagcaatgagtactatc
atacctccagttccactggccaaccctgagaaccagttccggtcagattatatcaagagc
atagcccctatcactgactttgaatattcccaggagttctttgaccatgtgaagaagctg
tgggacgatgaaggagtgaaggcctgctttgagagatccaacgagtaccagctgatcgac
tgtgcacaatacttcctggaaaggattgacagtgtcagtctggttgactacacacccaca
gaccaggacctgctcagatgcagagtgctgacatcaggaatctttgagacacgattccaa
gtggacaaagtgaactttcacatgtttgatgttggaggccagagagatgagagaagaaaa
tggatccagtgttttaatgatgtcactgcgatcatttacgtggcggcctgtagtagctac
aacatggtgatccgggaagataacaataccaacagacttcgggaatcactggacctgttt
gaaagcatctggaataacaggtggttgcgaaccatttctatcatcctattcttgaacaaa
caagacatgctggcagaaaaagtcttggcagggaagtcaaaaatcgaagactatttcccg
gagtatgccaattatactgtccctgaagatgcaacaccagatgcgggagaagatcccaaa
gttacaagagcaaagttctttatccgggatctgttcttgaggatcagcacagccacgggt
gatggcaaacattactgctaccctcacttcacctgcgccgtggacacagagaacatccgc
agagtgttcaacgattgccgtgacatcatccagagaatgcatctcaagcagtacgaactc
ttgtga

DBGET integrated database retrieval system