KEGG   Mus musculus (mouse): 15488
Entry
15488             CDS       T01002                                 

Gene name
Hsd17b4, 17-beta-HSD, 17[b]-HS, 17[b]-HSD, DBP, MFE-2, MFP, MFP2, MPF-2, Mfp-, Mfp-2, perMFE, perMFE-2
Definition
(RefSeq) hydroxysteroid (17-beta) dehydrogenase 4
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu04146  Peroxisome
Module
mmu_M00861  beta-Oxidation, peroxisome, VLCFA
mmu_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    15488 (Hsd17b4)
   01040 Biosynthesis of unsaturated fatty acids
    15488 (Hsd17b4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    15488 (Hsd17b4)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     15488 (Hsd17b4)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     15488 (Hsd17b4)
    4.2.1.119  enoyl-CoA hydratase 2
     15488 (Hsd17b4)
SSDB
Motif
Pfam: MaoC_dehydratas adh_short adh_short_C2 SCP2 KR Alkyl_sulf_C MaoC_dehydrat_N Spiralin AbrB-like Epimerase DUF853
Other DBs
NCBI-GeneID: 15488
NCBI-ProteinID: NP_032318
MGI: 105089
Ensembl: ENSMUSG00000024507
Vega: OTTMUSG00000021126
UniProt: P51660
Position
18; 18 D1
AA seq 735 aa
MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDFKGIGKGSSAADKVVA
EIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIH
RVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQANYSAAKLGILGLCNTLAI
EGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVG
AGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSNASKPQTIQESTGGIVEVLH
KVDSEGISPNRTSHAAPAATSGFVGAVGHKLPSFSSSYTELQSIMYALGVGASVKNPKDL
KFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFAKALHGEQYLELYKPLPRSG
ELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQFSVFVVGSGGFGGKRTSEKLKAA
VAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDFASVAGFEKPILHGLCTFGFSA
RHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWKEGNRIHFQTKVHETGDVVISNA
YVDLVPASGVSTQTPSEGGELQSALVFGEIGRRLKSVGREVVKKANAVFEWHITKGGTVA
AKWTIDLKSGSGEVYQGPAKGSADVTIIISDEDFMEVVFGKLDPQKAFFSGRLKARGNIM
LSQKLQMILKDYAKL
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcttcgccgctgaggttcgacgggcgtgtggtcttggtcaccggcgccgggggagga
ttgggccgagcttacgccctggcgtttgcagaaagaggagcattagtcattgtgaacgac
ttaggaggggacttcaagggaattggtaaaggctcctctgctgcagacaaggttgtggca
gagataagaaggaaaggcggaaaagcagtggccaattacgattcagttgaagcaggcgag
aagcttgtgaagacggcactggacacatttggcagaatagacgttgtggtcaacaatgct
ggaatcctgagggaccgttccttctccaggataagtgatgaagactgggatataattcat
agagttcatttgcggggctccttccaagtgacccgggcagcatgggaccatatgaagaaa
cagaattatggaagaatccttatgacttcctcagcttctggaatatatggcaactttggc
caggcgaattatagtgctgcaaagctgggcattctgggtctctgcaatactctcgccatt
gaaggcaggaagaacaacattcattgcaacaccattgcccccaacgctgggtcacggatg
acggagactgtgttgccggaagatcttgttgaagccctgaagccagagtatgtggcccct
ctggtgctttggctttgccatgagagctgtgaggaaaatggtggcctatttgaggttgga
gcaggatggattggaaaattgcgctgggagaggaccctgggcgccatcgtcagaaagcgg
aatcagcccatgactcccgaggcagtgagggacaactgggagaagatctgtgacttcagc
aatgccagcaagccgcagaccattcaagaatcaacaggtggtatagtcgaagttttacat
aaggtagattcagaaggaatctcaccaaaccgtaccagtcacgcggcacctgcagccacg
tcaggattcgttggtgctgttggccataaacttccttcattttcttcttcgtatacggag
ctgcagagtattatgtatgccctcggagtgggagcgtcagtcaaaaatccaaaggatttg
aagtttgtttatgaaggcagtgctgacttctcctgtttgcccaccttcggagtcattgtc
gctcagaagtccatgatgaatggagggctggcagaggttcctgggctgtcattcaacttt
gcaaaggctcttcacggggagcagtacttggagctgtataagccacttcctcgatcagga
gaattaaaatgtgaagcagttattgctgacatcctggataaaggctctggcgtagtgatt
gttatggacgtctattcttattctgggaaggaacttatatgctataatcagttctctgtc
tttgttgttggctctgggggctttggtggaaaacggacatcagaaaaactcaaagcagct
gtagctgtaccaaatcgacctccagatgctgtactgagagatgccacctcactgaatcag
gccgcgctgtaccgcctcagcggagactggaatcctctacacattgacccggactttgcg
agcgttgccggttttgagaagcccatattacatggactatgtacctttggattttctgca
aggcatgttttacagcagtttgcagataatgatgtatcaagattcaaggcgattaaggtt
cgttttgccaaaccagtgtatccaggacagactctacaaactgagatgtggaaggaagga
aacagaattcattttcaaaccaaggtccacgagactggagatgttgtcatttcaaatgcg
tacgtggatctcgtgcctgcatctggagtttcaacccagacaccttcagagggtggagag
ctccagagtgctcttgtgtttggggagataggccgccgcctcaagagtgttggccgtgag
gtggtaaagaaagcgaatgctgtgtttgaatggcatatcacgaaaggtgggactgttgca
gccaagtggaccattgacctgaagagcggctcaggggaggtgtaccaaggccccgcaaag
ggctctgctgatgtgaccatcatcatttccgatgaggattttatggaagtggtcttcggc
aagcttgacccacagaaggccttcttcagtggcaggctgaaggccagagggaacatcatg
ctgagccagaaactacagatgattcttaaagactatgccaagctctga

DBGET integrated database retrieval system