KEGG   Mus musculus (house mouse): 16563
Entry
16563             CDS       T01002                                 
Symbol
Kif2a, C530030B14Rik, Kif2, Kns2, M-kinesin
Name
(RefSeq) kinesin family member 2A
  KO
K10393  kinesin family member 2/24
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16563 (Kif2a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16563 (Kif2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     16563 (Kif2a)
  Centrosome formation proteins
   Spindle formation proteins
    16563 (Kif2a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16563 (Kif2a)
SSDB
Motif
Pfam: Kinesin Microtub_bd UPF0242
Other DBs
NCBI-GeneID: 16563
NCBI-ProteinID: NP_001139251
MGI: 108390
Ensembl: ENSMUSG00000021693
UniProt: P28740 Q9D481
Position
13:complement(107095504..107158931)
AA seq 705 aa
MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIF
SLNPDLVPDEDIEPSPELPPPSSSSKVNKIVKNRRTVAAVKNDPPPRDNRVVGSARARPS
QLPEQSSSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELR
EKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQMK
DLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVETI
FERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKPNYKKLELQ
VYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSCR
TSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLEGAEI
NKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTL
NTLRYANRVKELTVNPAAAGDVHPIMHHPPSQIDDLETQWGVGSSPQRDDLKLLCEQNEE
EVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWIEDEKALLEMTEEVDYDVDSYAT
QLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL
NT seq 2118 nt   +upstreamnt  +downstreamnt
atggcaacggccaacttcggcaagatccagatcgggatttacgtggagatcaagcgcagc
gatggccgaatacaccaagcaatggtaacatctttaaatgaagataatgaaagtgtaact
gttgagtggatagaaaatggagatacgaaaggcaaagagattgacttggagagcatcttt
tcacttaaccctgaccttgtacctgatgaagatattgagcccagtccagaactacctcca
ccctcgtcatcctcaaaagttaacaaaattgtaaagaaccggcggactgtggcagctgtt
aagaatgaccctcccccgagagataatagagtggttggttcagcacgcgcacggcctagt
cagcttcctgagcaatcgtcttctgcacaacagaatggtagcgtttcagatatatctcca
gttcaagctgcaaaaaaggagtttggccctccttcacgtagaaaatccaattgtgtgaaa
gaagtagaaaaattgcaagaaaaacgagaaaaaaggagattgcaacagcaagaacttaga
gaaaaaagagcccaggatgttgatgctacaaatccaaattacgaaattatgtgtatgatc
agagacttcagagggagcttggattacagacccctaacaacagcagatcctattgatgaa
cataggatatgtgtttgtgtaagaaaacgaccactcaataaaaaagaaactcaaatgaaa
gatcttgatgtgatcacaatccctagtaaagatgttgtgatggtccacgaacccaaacag
aaagtagacttaacaaggtacttagaaaatcagacatttcggtttgattacgccttcgat
gactcagctcctaatgaaatggtttacaggtttactgctaggccactagtggaaacaata
tttgaaaggggcatggctacgtgctttgcttatgggcagactggaagtgggaaaactcat
actatgggtggtgacttttcaggaaagaaccaggattgttctaagggaatttatgcatta
gcagctcgcgatgtctttttaatgctgaagaagccaaactataagaaactagaacttcaa
gtatatgcaacattttttgaaatttatagtggaaaggtgtttgacttactaaataggaaa
acaaaattaagagtactagaagatgggaagcagcaggtccaagtggtggggctgcaggag
cgggaggtgaagtgtgtggaggacgtgctgaagctcatcgacataggcaacagctgcaga
acatctggccaaacatctgcaaatgcacattcatctcggagccatgcagtgttccagatc
attctaagaaggaaggggaaactacatggtaaattttctctcattgacctggctgggaac
gaaagaggagctgatacatccagtgcagacaggcaaaccaggcttgaaggtgctgaaatt
aataaaagccttttagcactcaaggagtgcatccgagccttaggtagaaacaaaccccat
acgcctttccgagcgagcaaactcactcaggtgctgagagattccttcataggtgaaaat
tctcgtacctgcatgattgccacaatctctccaggaatggcatcctgtgaaaatactctt
aatacgttaagatatgcaaatagggtgaaagaattgactgtaaatccagctgctgctggc
gatgtccatccaataatgcaccatccaccgagccagattgatgacttagagacacagtgg
ggtgtggggagttctcctcagagagatgatctaaaacttctctgtgaacaaaatgaagaa
gaagtttctccacagctgttcactttccatgaagctgtctcccagatggtagagatggaa
gagcaggttgtggaagatcatagggcagtgttccaggaatccattcgctggatagaagat
gaaaaggctctcctagagatgactgaagaagtagactatgatgtagactcatatgctaca
caacttgaagctattcttgagcaaaaaatagacattttaactgagttacgagataaagtg
aaatcttttcgcgcagcgctacaagaagaagagcaagcaagcaagcaaattaaccccaag
aggccccgagccctctaa

DBGET integrated database retrieval system