KEGG   Mus musculus (mouse): 19184
Entry
19184             CDS       T01002                                 

Gene name
Psmc5, Rpt6, mSUG1
Definition
(RefSeq) protease (prosome, macropain) 26S subunit, ATPase 5
  KO
K03066  26S proteasome regulatory subunit T6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19184 (Psmc5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19184 (Psmc5)
   05012 Parkinson disease
    19184 (Psmc5)
   05016 Huntington disease
    19184 (Psmc5)
   05017 Spinocerebellar ataxia
    19184 (Psmc5)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19184 (Psmc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19184 (Psmc5)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     19184 (Psmc5)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 IstB_IS21 AAA_18 Mg_chelatase AAA_3 ATPase PhoH AAA_28 Sigma54_activat AAA_24 AAA_14 AAA_7 AAA_17 AAA_25 Parvo_NS1 DUF815 RNA_helicase TsaE AAA_19 AAA_11 Zeta_toxin Prominin
Other DBs
NCBI-GeneID: 19184
NCBI-ProteinID: NP_032976
MGI: 105047
Ensembl: ENSMUSG00000020708
Vega: OTTMUSG00000003290
UniProt: P62196
Position
11; 11 E1
AA seq 406 aa
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgcttgatgggccagagcagatggaactggaagaggggaaggcaggcagtggactc
cgtcaatattatctgtccaagattgaagaactccagttgattgtaaatgataagagccag
aatctccgtagactgcaggcacagaggaatgagctgaatgcaaaagttcgcctgttgcgg
gaggagctgcagctgttgcaggaacagggctcctacgttggagaagtcgtgagggccatg
gataagaaaaaagtattggtcaaggtccatcctgagggcaaatttgttgttgatgtggac
aagaacattgatatcaacgatgtgacgcccaattgtcgggtcgctctaagaaatgacagc
tacactctgcataagatcttacctaacaaggtggaccctttggtgtcactaatgatggtg
gagaaggtgccagactcaacctacgagatgattggcggcctggacaagcagatcaaggag
attaaagaagtgatcgagctgcccgtgaagcaccccgagctctttgaagcactgggcatc
gcacagccaaagggagtcctgctctacggacccccaggcactgggaagacattgttggcc
cgcgctgtggctcatcatacagactgtacctttattcgtgtctctggctctgaactggta
cagaaattcatcggggaaggggcaagaatggtgagggagctgtttgtcatggcccgagaa
catgctccatccatcatcttcatggacgagattgactctattggctcctcacggctggag
gggggctctggaggcgacagtgaggtacagcgcacgatgctggaactgctcaatcagctg
gatggctttgaggccaccaagaatatcaaggttatcatggctactaataggattgatatc
ctggactctgccctgcttcgtcctgggaggattgacagaaaaattgaattcccacccccc
aacgaggaggcccggctggacattttgaaaatccactctcggaaaatgaacttgaccagg
gggatcaacctgaggaaaattgctgagttgatgccgggagcttcaggggctgaagtgaag
ggtgtgtgcacagaagctggcatgtacgccctgcgggaacggcgtgtccacgtcactcag
gaggactttgagatggcagtagctaaggtcatgcaaaaggatagtgagaaaaacatgtcc
atcaagaagctatggaagtga

DBGET integrated database retrieval system