KEGG   Mus musculus (mouse): 19332
Entry
19332             CDS       T01002                                 

Symbol
Rab20, AA536966, D8Ertd350, D8Ertd350e
Name
(RefSeq) RAB20, member RAS oncogene family
  KO
K07911  Ras-related protein Rab-20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19332 (Rab20)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab20/21/24 [OT]
    19332 (Rab20)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU SRPRB TniB PduV-EutP
Other DBs
NCBI-GeneID: 19332
NCBI-ProteinID: NP_035357
MGI: 102789
Ensembl: ENSMUSG00000031504
Vega: OTTMUSG00000060750
UniProt: P35295 Q3TPA7
Position
8 A1.1; 8 5.73 cM
AA seq 233 aa
MRKPDGKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSFNISIWDTAGRE
QFHGLGSLYCRGAAAIILTYDVNHPQSLFELEDRFLGLTETANNDCLFAIVGNKVDLTSE
RDTEGGEKEGPASGKVGSCVSTKVPKQVQPEDAVALYKKILKYKMLDEREMPAAEQMCFE
TSAKTGYNVDLLFETLFDLVVPMIMRQRAEESDQTVDIASCKTPKQTRSGCCA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcggaagccggatgggaagatcgtactgctgggggacatgaacgtgggtaaaacgtcg
ctgctgcagcgctacatggagcgtcgcttcccggacacggtcagcaccgtgggcggcgcc
ttctacctgaagcagtggcgttccttcaacatctccatatgggacaccgcagggcgggag
cagtttcatggtctgggctccctgtactgccgcggagcggccgctatcatccttacatac
gatgtgaaccacccacagagcctgtttgagctggaggacagattcctgggcctgacagaa
acagccaacaatgactgcctgtttgccattgtggggaacaaagtggacctgacctcggag
cgggacaccgagggcggggagaaggaaggaccggcctctggcaaggtgggcagctgtgtc
tccaccaaggtacccaagcaggtgcagccagaggatgcagtggccctttacaagaagatc
ctgaagtacaagatgctggatgagagggagatgccagctgctgagcagatgtgcttcgag
accagtgccaagactggatacaatgtggacctcctctttgaaaccttgtttgacctggtg
gtacctatgatcatgcggcagagggctgaggagtcagatcagactgtggatatagccagc
tgcaaaacacccaaacagactagatccgggtgttgtgcctaa

DBGET integrated database retrieval system