KEGG   Mus musculus (mouse): 193736
Entry
193736            CDS       T01002                                 

Gene name
Zbtb12, BC020447, Bat, Bat-, Bat-9, Bat9, G10, NG35
Definition
(RefSeq) zinc finger and BTB domain containing 12
  KO
K10499  zinc finger and BTB domain-containing protein 12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    193736 (Zbtb12)
   04121 Ubiquitin system [BR:mmu04121]
    193736 (Zbtb12)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    193736 (Zbtb12)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     193736 (Zbtb12)
SSDB
Motif
Pfam: BTB zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-met zf-H2C2_5 zf-C2H2_2 Zn_ribbon_SprT zf-Di19 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 193736
NCBI-ProteinID: NP_942589
MGI: 88133
Ensembl: ENSMUSG00000049823
Vega: OTTMUSG00000037274
UniProt: Q9Z150
Position
17 B1; 17 18.43 cM
AA seq 459 aa
MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
QFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCR
NALSQFIEPKIGLKEDGVSEASLLSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPV
KLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVAHRLKPPGSLAGGLGIGASVS
SHLGELAQSSVAPNTVTPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAV
AMAARGAGGSLGAGGSRGPLPGGFSSGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFM
CPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYC
DVRFAHKPAIRRHLKEQHGKTTAENVLEAGVAEINVLIR
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggcctctggggtggaagtcctgcgcttccagctgcctggccacgaggccgcaacgttg
cggaacatgaaccagctccgtgcagaggagcggttctgtgatgtgaccatcgtggccgac
agcctcaaattccgtggccacaaggtcatcctggccgcctgctcaccgttcctccgggac
cagttcttgctgaaccccagttctgagctgcaggtctcactgatgcacagcgcgcgtatt
gtggcggacttgctcctctcttgctacacaggcgccctggagttcgcagtcagggacatc
gtgaactacctgacagcagcctcctacctgcaaatggagcatgtagtggagaaatgccgg
aacgcccttagccagttcattgagcccaaaataggccttaaagaagatggggtcagcgag
gctagcctcctaagcagtgtcagtgccaccaagtccctcctccctccagccaggacccca
aagccagctccaaaacccccaccaccacctcctctaccccctccgctcctgcgaccggtg
aagctggagtttccgctggatgaggacctagagctgaaggcggaagaggaggatgaggat
gaagatgaagatgtttctgacatctgcatcgtcaaagtggagtcggctctagaagtggca
caccggctcaaaccccctggaagcctagccgggggtctgggtatcggggcctctgtgagc
agccacctgggagagctggcccagagtagtgtggcccccaacactgttaccccaccgcaa
ggggtggtgaaggcatgctacagcctgtcagaggacgcggaaggggaaggcctgttgttg
atcccaggaggccgggccagtgtgggggccacctcgggcctagtggaagcagcagcggtg
gccatggctgcccggggggcggggggcagtctgggggcagggggtagccggggacctctg
cctgggggcttctcaagtggaaaccccttaaagaacatcaaatgcaccaaatgccctgaa
gtgttccagggtgtggagaagctggtcttccacatgcgtgcgcaacacttcatcttcatg
tgcccacgctgcggcaagcagttcaaccacagcagcaacctcaaccgccacatgaacgtc
caccgtggtgtcaagtcccattcatgtggcatctgcggcaagtgctttactcagaagtcc
acactgcacgatcacctcaacctgcactcaggagcccggccctaccggtgctcctactgt
gacgtgcgctttgcccacaagcccgccattaggcggcacctcaaggagcagcatggcaaa
accacagctgagaacgtgctggaagctggtgtggctgagatcaatgtcctcatccgctga

DBGET integrated database retrieval system