KEGG   Mus musculus (mouse): 19700Help
Entry
19700             CDS       T01002                                 

Gene name
Rem1, E030011C07Rik, Ras, Rem
Definition
(RefSeq) rad and gem related GTP binding protein 1
  KO
K07847  Rad and Gem related GTP binding protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19700 (Rem1)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rad/Gem/Kir [OT]
    19700 (Rem1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf AAA_22 FeoB_N RsgA_GTPase AAA_16 ABC_tran AAA RuvB_N AAA_24 AAA_5 AAA_18 MMR_HSR1 NACHT DUF2369 NTPase_1
Motif
Other DBs
NCBI-GeneID: 19700
NCBI-ProteinID: NP_033073
MGI: 1097696
Ensembl: ENSMUSG00000000359
Vega: OTTMUSG00000015816
UniProt: O35929
Position
2; 2 H1
AA seq 297 aa AA seqDB search
MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSQHPRLGQSVSLNPPVRKPS
PAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQDRDPHEQLGGVYERTL
SVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRR
THQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVR
QLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARRRALKARSKSCHNLAVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgactcttaacacccagcaggaagcaaagaccactctgcgacgtcgagcaagcacacca
ctacccctgtcgtccaggggccaccagcctggccgcctgtgcacagcaccctctgctcca
tcccagcatccccgactgggtcagtcagtctctctcaaccctcccgtccggaaaccctcc
cctgcccaggatgggtggtcctctgaatccagcgactccgaaggctcttgggaggcactc
taccgggtggtgcttcttggagaccctggtgttgggaagactagcctggctagcctcttc
gcagagaaacaagaccgagaccctcacgagcagctgggaggtgtgtacgagagaacgctg
tcagtggacggagaggacaccactctggtggtcatggacacctgggaggctgagaaactg
gatgaaagctggtgccaggagtcatgcctgcaggcaggcagcgcctacgtcatcgtgtac
tccatagcggatcgcagcagctttgagagcgcctcggagctccgaatccagctgaggcgc
acgcatcaggccaaccacgtgcccatcatcctggtgggcaacaaggccgacctggcccgc
tgccgggaagtctcggtagaagagggtcgcgcctgcgccgtggtgttcgactgcaagttc
atcgagacttcggccactctgcagcacaatgtgacagagctcttcgagggcgtggtgcgc
caactgcgcctgcgccgccaggacaatgcagccccggagacaccttcacctcgacgacgg
gccagcttgggccagcgcgcccgccgattcctggcacgtctgacagcacgcagcgcacga
cgccgggcacttaaagcccgctccaagtcctgccacaacctggctgtgctctga

DBGET integrated database retrieval system