KEGG   Mus musculus (mouse): 20818Help
Entry
20818             CDS       T01002                                 

Gene name
Srprb, AA409543
Definition
(RefSeq) signal recognition particle receptor, B subunit
  KO
K12272  signal recognition particle receptor subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    20818 (Srprb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    20818 (Srprb)
   04031 GTP-binding proteins [BR:mmu04031]
    20818 (Srprb)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   20818 (Srprb)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Unclassified
   20818 (Srprb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRPRB Arf MMR_HSR1 GTP_EFTU Roc FeoB_N Ras Gtr1_RagA G-alpha Dynamin_N
Motif
Other DBs
NCBI-GeneID: 20818
NCBI-ProteinID: NP_033301
MGI: 102964
Ensembl: ENSMUSG00000032553
Vega: OTTMUSG00000035366
UniProt: P47758
Structure
PDB: 

Position
9; 9 F1
AA seq 269 aa AA seqDB search
MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAVLLTLVFWKFIWSRKS
SQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHE
SLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMALKNSPSLLIACNKQ
DIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVE
FLECSAKGGRGDTGSADIQDLEKWLAKIA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggcgaacacccggcgagttggcgatggcgccggtggcgccttccagccttac
ctcgactccttacgacaggagctgcagcagagggatccgacgctgctctccgtggcggtg
gctctcctggcggtgctgctgacgctggtgttctggaagttcatctggagccgaaagagc
agtcagagagctgttctcttcgttggtctctgtgactctgggaaaacgttgctgtttgtc
aggttgctaactggccagtacagagacacacagacttccattaccgatagttctgccata
tacaaagtcaacaataacaggggtaacagcctgactctgatcgacctccccgggcatgag
agcttgaggtttcagctcttagatcgctttaagtcttcagctagggctgtggtgtttgtg
gtggacagtgcggcgttccagcgggaggtgaaagatgtggccgaatttctgtaccaggtc
ctcatcgacagcatggctctgaagaactcaccgtccttattaatagcctgcaataagcaa
gatatcgcaatggcaaaatcagcgaagttgatccagcagcagcttgagaaggagctcaac
accttacgagtcacccggtccgcggctcccagcacactggacagttccagcaccgcacct
gctcagttggggaagaaaggcaaagaatttgaattttcccagttgccactcaaagtggag
ttcctggagtgtagtgccaagggtggacgaggggacactggctctgctgacatccaggac
ttggagaagtggctggccaagattgcctga

DBGET integrated database retrieval system