KEGG   Mus musculus (mouse): 215449Help
Entry
215449            CDS       T01002                                 

Gene name
Rap1b, 2810443E11Rik
Definition
(RefSeq) RAS related protein 1b
  KO
K07836  Ras-related protein Rap-1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04934  Cushing's syndrome
mmu04972  Pancreatic secretion
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    215449 (Rap1b)
   04015 Rap1 signaling pathway
    215449 (Rap1b)
   04010 MAPK signaling pathway
    215449 (Rap1b)
   04024 cAMP signaling pathway
    215449 (Rap1b)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    215449 (Rap1b)
 Organismal Systems
  Immune system
   04611 Platelet activation
    215449 (Rap1b)
   04670 Leukocyte transendothelial migration
    215449 (Rap1b)
   04062 Chemokine signaling pathway
    215449 (Rap1b)
  Digestive system
   04972 Pancreatic secretion
    215449 (Rap1b)
  Nervous system
   04720 Long-term potentiation
    215449 (Rap1b)
   04722 Neurotrophin signaling pathway
    215449 (Rap1b)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    215449 (Rap1b)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    215449 (Rap1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   215449 (Rap1b)
  Exosomal proteins of other body fluids (saliva and urine)
   215449 (Rap1b)
  Exosomal proteins of colorectal cancer cells
   215449 (Rap1b)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rap [OT]
    215449 (Rap1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha
Motif
Other DBs
NCBI-GeneID: 215449
NCBI-ProteinID: NP_077777
MGI: 894315
Ensembl: ENSMUSG00000052681
UniProt: Q99JI6 Q52L50
Position
10; 10 D2
AA seq 184 aa AA seqDB search
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS
CQLL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaatataagctcgtcgtgcttggatcaggaggcgttgggaagtcagccctgact
gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat
agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggacactgcagga
acggagcaattcacagccatgagggacctgtacatgaagaacggacaaggcttcgctctg
gtttactccatcacagcacagtcgacatttaacgacttacaagatctaagagagcagatt
ctgcgggttaaagacactgatgatgttccaatgattctggttggcaataaatgcgacttg
gaagatgaaagagttgtaggaaaggaacaaggtcagaacctagcaagacagtggaacaac
tgtgcattcttagaatcctctgcaaagtccaaaataaatgttaatgagatcttttatgac
ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatcg
tgtcagctgctttaa

DBGET integrated database retrieval system