KEGG   Mus musculus (house mouse): 21846
Entry
21846             CDS       T01002                                 
Symbol
Tie1, D430008P04Rik, TIE, tie-1
Name
(RefSeq) tyrosine kinase with immunoglobulin-like and EGF-like domains 1
  KO
K05120  tyrosine kinase receptor 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    21846 (Tie1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     21846 (Tie1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   21846 (Tie1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase fn3 ig I-set Ig_3 Pur_ac_phosph_N Ig_2 EGF_2 hEGF C2-set Pkinase_fungal TadZ_N Haspin_kinase DUF4702 APH EGF
Other DBs
NCBI-GeneID: 21846
NCBI-ProteinID: NP_035717
MGI: 99906
Ensembl: ENSMUSG00000033191
UniProt: Q06806
Position
4:complement(118328388..118347046)
AA seq 1134 aa
MVWWGSSLLLPTLFLASHVGASVDLTLLANLRITDPQRFFLTCVSGEAGAGRSSDPPLLL
EKDDRIVRTFPPGQPLYLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVLYVHNS
PGAHLFPDKVTHTVNKGDTAVLSAHVHKEKQTDVIWKNNGSYFNTLDWQEADDGRFQLQL
QNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCVKDCPGCLHGGVCHDHDG
ECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTAGCRGLTFCLPDPYGCSCGSGWRGSQC
QEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILSMATEVEF
NIGTMPRINCAAAGNPFPVRGSMKLRKPDGTMLLSTKVIVEPDRTTAEFEVPSLTLGDSG
FWECRVSTSGGQDSRRFKVNVKVPPVPLTAPRLLAKQSRQLVVSPLVSFSGDGPISSVRL
HYRPQDSTIAWSAIVVDPSENVTLMNLKPKTGYNVRVQLSRPGEGGEGGWGPSALMTTDC
PEPLLQPWLESWHVEGPDRLRVSWSLPSVPLSGDGFLLRLWDGARGQERRENISFPQART
ALLTGLTPGTHYQLDVRLYHCTLLGPASPPAHVHLPPSGPPAPRHLHAQALSDSEIQLMW
QHPEAPSGPISKYIVEIQVAGGSGDPQWMDVDRPEETSIIVRGLNASTRYLFRVRASVQG
LGDWSNTVEEATLGNGLQSEGPVRESRAAEEGLDQQLVLAVVGSVSATCLTILAALLALV
CIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLSYPVLEWEDITFEDL
IGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLL
GACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAA
NGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIES
LNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYE
LMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
NT seq 3405 nt   +upstreamnt  +downstreamnt
atggtctggtggggatcctctttgctgctccccactcttttcttggcctctcatgttggt
gcgtctgttgacttaacattgctggccaacctgcgcatcacagacccccagcgtttcttc
ctgacctgcgtgtctggtgaggccggagcagggaggagctcggacccgcccctgctgctg
gagaaggatgatcgcatcgtgcgcaccttcccgcctgggcagcccctgtacctggcacgc
aacggttctcaccaggtcacgctgaggggcttctccaagccctcggatttggtaggcgtc
ttctcctgtgtgggtggtgctggcgcgcggcgcactcgagttctctatgtgcacaacagc
ccaggggcacacctgtttccagacaaggtcacacacacggtgaacaaaggtgacactgct
gtgctttctgcccatgtgcacaaggaaaagcagactgacgtgatctggaagaacaacgga
tcctacttcaataccctagactggcaagaggccgatgacgggcgttttcaactgcagctc
caaaatgtacagccaccatcaagtggcatctacagtgccacctacctagaggccagcccc
ctgggcagtgccttctttcggctcatcgtgcgaggctgtggggctggacgctgggggcca
ggatgtgtcaaggattgcccaggctgcctgcatggaggtgtctgtcatgaccatgatggc
gaatgtgtgtgtcccccaggattcactggcacccgctgtgagcaggcctgcagggagggt
cgttttggacagagctgtcaggaacagtgcccaggcacagcaggttgtagaggtctcacc
ttctgcctcccggatccctatggctgttcctgtggatctggctggagaggaagccagtgc
caggaagcatgtgcacctggtcattttggggctgattgtcgcctccagtgccagtgtcaa
aatggtggcacttgtgaccggttcagcggctgcgtctgcccctctgggtggcatggagtc
cactgtgaaaagtcagaccggatcccccagatcctcagtatggccacagaggtggagttc
aacatagggacgatgccccggatcaactgtgcagctgccgggaatcccttcccagtgcgg
ggcagcatgaaacttcgcaagccagatggcaccatgcttttgtctaccaaagtcattgtg
gagccagacaggaccacagcagagtttgaagtgcccagtttgactcttggggacagtggg
ttctgggaatgccgcgtatcgacttctggtggccaagacagccggcgcttcaaggtcaat
gtcaaagtacccccagtgcctttgactgcacctcgactcctggccaagcagagccgtcag
cttgtggtctccccactggtctcctttagtggggatggacccatctcctctgtccgcctg
cactaccggccccaggacagcacgattgcctggtctgccattgtggtggatcccagtgag
aatgtgacattaatgaacctgaagccaaagacaggatacaatgtccgagtgcagctgagc
cggccaggggaaggaggagaaggaggctggggaccttctgcccttatgactactgactgt
cctgagcctttgctgcagccctggctagagagctggcacgtggagggtcctgacaggctc
cgtgtgagctggtctctaccctcggtgccactgtccggtgatggtttcctgctgcgcctg
tgggatggggcccggggacaggagaggcgggagaacatctcattcccccaggcccgcact
gccctcctgactggactcacgccgggcacccactaccagctggatgtgcgactgtatcac
tgtaccctcctgggccctgcctcaccccctgcgcatgtgcacctgccccccagcgggcct
ccagctccccgccacctccatgcccaggccctctcagactctgagattcaactcatgtgg
cagcatcccgaggctccgtctgggcctatatccaagtacatcgtggagattcaggtggcc
gggggctcaggagacccacagtggatggatgtagacaggcccgaggagacaagcatcatt
gttcgtggcctcaatgctagcacacgatatcttttccgtgtgcgggccagtgtgcagggt
cttggcgactggagcaatacagtagaagaggccactctgggcaatgggctgcagagtgag
ggcccagtccgagaaagccgggcagctgaagaaggcctggatcagcagctggtcctggct
gtggtaggttccgtctctgccacctgcctcaccatcctggctgcccttttagccttggtg
tgtatccgaagaagctgcctacatcggagacgcaccttcacttaccagtcaggatcgggt
gaagagaccatcctgcagttcagctcagggaccttgaccttgacccggcgaccgaagcca
cagcctgagcccttgagttaccccgtgctggagtgggaggacatcacctttgaggacctc
ataggggagggcaactttggccaagtgatccgggccatgatcaagaaggacgggctcaag
atgaacgcagccatcaagatgctaaaagagtatgcgtctgaaaatgaccatcgagacttt
gcaggtgaactagaagttctgtgcaaactaggacaccaccccaatattatcaacctcttg
ggggcctgtgagaaccgaggctacttgtatattgctatcgaatacgccccctatggaaac
ctactggacttcctgagaaagagcagggtcctggagactgatccagcttttgctcgagag
catgggacggcctccacactcagctctcggcagctgctgcgctttgccagtgatgcagcc
aacggcatgcagtaccttagtgagaagcagttcattcacagggacctggctgcccgaaat
gtgctggtcggagagaacctggcctccaagattgcagactttggcctttctcgaggggag
gaggtgtatgtgaagaagacaatgggccgtctccctgtgcgttggatggccattgagtcc
ctcaactacagcgtctataccaccaagagtgatgtctggtcctttggggtcctcctctgg
gagatagtgagccttggaggcacgccctactgtggcatgacctgtgctgagctctacgag
aagctgcctcaaggctatcgcatggagcagcctcgaaactgcgatgacgaagtgtacgag
ctgatgcggcagtgctggcgggatcggccctatgagcgccccccctttgctcagatcgca
ctacagttgggccgcatgctggaagccaggaaggcctacgtgaacatgtcgctgtttgag
aacttcacctatgcgggcatcgatgccacagctgaggaggcctag

DBGET integrated database retrieval system