KEGG   Mus musculus (house mouse): 21892
Entry
21892             CDS       T01002                                 
Symbol
Tll1, Tll, Tll-1, b2b2476Clo
Name
(RefSeq) tolloid-like
  KO
K09608  tolloid-like protein 1 [EC:3.4.24.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    21892 (Tll1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   21892 (Tll1)
SSDB
Motif
Pfam: CUB Astacin FXa_inhibition EGF_CA cEGF EGF_3 EGF CUB_2 Peptidase_M10 hEGF Reprolysin_4
Other DBs
NCBI-GeneID: 21892
NCBI-ProteinID: NP_001411845
MGI: 106923
Ensembl: ENSMUSG00000053626
Position
8:complement(64466132..64659043)
AA seq 964 aa
MMGGQRQSVFWGDIALDDEDLNIFQIDRTIDLTQSPFGKLGHITGGFGDHGMPKKRGALY
QLIERIRRIGSGLEQNNTMKGKAPPKLSEQSEKNRVPRAATSRTERIWPGGVIPYVIGGN
FTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIG
KNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGE
RYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPAC
GETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEV
RDGYWRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKN
EGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASEN
SPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQR
CLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVI
APSQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMR
IEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDC
KEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAY
DHLEIFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATHSTECGG
RLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYV
EVFDGLSSKAVGLGRFCGSGPPEEIYSIGDVALIHFHTDDTINKKGFYIRYKSIRYPETM
HAKN
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgatgggaggtcagaggcaatctgtgttttggggtgacatcgccttagatgatgaagac
ttaaatatcttccaaatagacaggacaattgacctgacccagagcccctttggaaaactt
ggacatattacaggtggctttggagaccatggcatgccaaagaagcgaggggcactctac
caacttatagagaggatcagaagaattggctctggcttggagcaaaataacacgatgaag
ggaaaagcacctccaaaattgtcagagcaaagtgagaaaaatcgagttcccagagctgct
acctcaagaacggaaaggatatggcctgggggtgtcattccttatgtcataggaggaaac
tttactggcagccagagagccatgttcaagcaggccatgagacactgggaaaagcacacc
tgtgtgacgttcactgagagaagtgatgaagaaagttatattgtgttcacctacaggcct
tgtggatgctgctcctatgttggtcggcggggaaatggccctcaggccatctctattggc
aagaactgtgacaagtttggaattgttgttcatgaactgggccacgtgataggcttctgg
catgaacatacccgcccagaccgagacaaccatgtcaccatcattagagagaacatccag
ccaggtcaagagtacaattttctaaagatggagcctggagaagtgaactctcttggggaa
agatatgattttgacagtatcatgcactacgccaggaacaccttctcaagagggatgttt
ttagacacaatactcccctcccgtgatgataatggcattcgtcctgcaattggtcaacgg
acccggttaagcaaaggagacattgcacaagcaagaaagctgtatcgatgcccagcatgt
ggagaaaccctgcaagaatccagtggcaacctttcttccccaggattcccaaatggctac
ccttcctacacacactgcatctggagagtgtctgtgaccccgggagaaaagattgtcttg
aattttaccacaatggacctttacaaaagtagtttgtgctggtatgattacattgaagta
agagatggttactggaggaagtcacctctccttggtagattctgtggggacaaagtggct
ggagttcttacatctacggacagcagaatgtggattgagtttcgtagcagcagtaactgg
gtaggaaaagggtttgcagctgtctatgaagcgatttgtggaggggagataaggaaaaac
gaagggcagattcagtctcccaattaccccgatgactaccgaccaatgaaggagtgtgta
tggaaaataatggtgtccgagggctaccatgttggactgacctttcaggcctttgagatc
gaaagacatgacagctgtgcctatgaccacctagaagttcgagatggagccagtgagaac
agccctttgataggacggttctgtggttatgacaaacctgaagatataaggtctacttcc
aacaccctgtggatgaagtttgtctctgacgggactgtgaacaaggcagggtttgctgcg
aacttttttaaagaggaagatgagtgtgccaaacctgaccgaggaggctgtgaacagagg
tgtcttaacacactaggcagctaccagtgtgcctgtgagcctggctatgaactggggcca
gacagaagaagctgtgaagctgcttgcggaggacttctgacgaagctcaatggcaccata
accacccccggctggcccaaagagtaccctccaaacaaaaactgtgtgtggcaagtgatc
gcgccaagccagtacagaatctctgtgaagtttgagttttttgaattggaaggcaatgaa
gtttgcaaatacgattacgtggagatctggagcggcctttcctctgagtctaaactgcat
ggcaagttctgtggcgctgacatacctgaagtgatgacttcccatttcaacaacatgagg
attgaattcaagtcagacaacactgtatccaagaagggcttcaaagcacattttttctca
gataaggatgagtgttcaaaggataatggtggctgtcagcatgagtgtgtcaacacgatg
ggaagttacacgtgtcagtgccggaatggattcgtgttgcatgagaacaagcatgattgc
aaggaagccgagtgtgaacagaagatacacagcccaagtggtctcatcaccagtcccaac
tggccagacaagtatccaagcaggaaagagtgcacgtgggtgatcagtgccattcctggc
caccgcatcacattagccttcaatgagtttgaggttgaacaacatcaagaatgtgcttat
gatcacttggaaatttttgatggagaaacggagaagtcaccaatacttggccgactatgt
ggcagcaagataccagatcccctcatggctactgggaatgaaatgtttattcggtttatt
tctgatgcctctgttcaaagaaaaggctttcaagctacacattccacagagtgtggtggt
cgattgaaagcagagtcaaagcctagagacctgtactcccatgctcagtttggtgataat
aactacccaggacaactggactgtgaatggttgttggtgtcagaacgaggatctcgactt
gaattgtccttccagacattcgaagtagaagaagaagctgactgtggctatgactatgtt
gaagtctttgatggtctcagttcaaaagctgtgggtcttggtagattctgtgggtcaggg
ccaccagaagaaatctattcaattggagatgtggctttgattcatttccacacagatgac
actatcaacaagaaaggattttatataagatataaaagtataagatacccggaaacgatg
catgccaagaactaa

DBGET integrated database retrieval system