KEGG   Mus musculus (mouse): 22210Help
Entry
22210             CDS       T01002                                 

Gene name
Ube2b, E2-14k, E214K, HR6B, Rad6b, mHR6B
Definition
(RefSeq) ubiquitin-conjugating enzyme E2B
  KO
K10574  ubiquitin-conjugating enzyme E2 B [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22210 (Ube2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22210 (Ube2b)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22210 (Ube2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     22210 (Ube2b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   22210 (Ube2b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    22210 (Ube2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD UEV
Motif
Other DBs
NCBI-GeneID: 22210
NCBI-ProteinID: NP_033484
MGI: 102944
Ensembl: ENSMUSG00000020390
Vega: OTTMUSG00000005613
UniProt: P63147 A2RSE4
Position
11; 11 B1.3
AA seq 152 aa AA seqDB search
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccccggcccgtaggaggctcatgcgggatttcaagcgattgcaagaggaccca
cctgtgggggtcagtggcgccccatctgaaaacaacatcatgcagtggaatgcagttata
tttggaccagaagggacaccctttgaagatggtacttttaaactagtaatagaattttct
gaagaatatccaaataaaccaccaaccgttaggtttttatccaaaatgtttcatccaaat
gtgtatgctgatggtagcatatgtttagatatcctgcagaatcgatggagtcccacatat
gatgtctcttccatcttaacttccattcagtctctgctggatgaaccgaatccaaacagt
ccagccaacagccaagcagcacagctttatcaggaaaacaaacgggagtatgagaagaga
gtttcggccattgttgagcaaagctggaatgattcataa

DBGET integrated database retrieval system