KEGG   Mus musculus (mouse): 223838
Entry
223838            CDS       T01002                                 

Gene name
Adamts20, ADAMTS, Adamst20, bt
Definition
(RefSeq) a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 20
  KO
K09609  a disintegrin and metalloproteinase with thrombospondin motifs 20 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    223838 (Adamts20)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     223838 (Adamts20)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   223838 (Adamts20)
Motif
Pfam: TSP1_ADAMTS GON TSP_1 Pep_M12B_propep ADAM_spacer1 Reprolysin TSP1_spondin ADAM_CR_2 TSP1_CCN Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4
Other DBs
NCBI-GeneID: 223838
NCBI-ProteinID: NP_803180
MGI: 2660628
Ensembl: ENSMUSG00000022449
Vega: OTTMUSG00000025504
UniProt: P59511 Q3UQW9
Position
15 E3; 15 48.2 cM
AA seq 1906 aa
MRVAKWLTGLLCPISLLLTGSWEVRFHPRQEALVKTLASYEVVTPTRVNEFGDVFPQNRH
FSRKKRSSGVPEPPPFRTHYRISAYGQLFQLNLSADAAFLAAGYTEVHLGTPVPGPGGRS
TESPDLRHCFYRGQVNAREDHTAVFSLCGGLMGTFKANDGEYFLEPVLRADGSAHDDDHN
KPHLIYRQELKRNSFARSHKPCEVSENQMEKTALPSQSSRNTTGDVDIEEEAVFRLEGER
SQLHSRNKRFLSYPRYVEVMVTADAKMVHHHGQNLQHYVLTLMSIVAAIYKDSSIGNLIN
IVIVKLVVIHSEQEGPVISFNAATTLRNFCLWQQSQNVPDDAHPSHHDTAVLITREDICG
AKEKCDTLGLAELGTLCDPSRSCSISEENGLSAAFTIAHELGHVFNVPHDDSFKCKEAGI
KHQYHVMAPTLNYHTSPWTWSACSQKHITEFLDTGHGECLLDKPNGRTYDLSPQLPGSVY
DGNRQCELMFGPGSQVCPYLKHCRRLWCTSAEGVHKGCRTQHMPLADGTSCGPGMHCHRG
LCVTRDMETRPVDGEWGPWGPYSSCSRTCGGGIKSTARLCDRPEPRNGGRYCVGRRMKFR
SCNTDSCPKGKRDFREKQCSDFDGKHFDINGLPPNVRWLPKYSGIAVKDRCKLYCRVAGT
TSFYQLKDRVADGTPCGTETNDICVQGLCRQAGCDHVLNSKAKRDKCGVCGGDNSSCQTL
AGVFNSAHYGYNVVVKIPAGATNIEILQHSYSGRPEDDNYLALSDTQGNFLLNGNFVVSM
AKKEINIQGAVFEYSGSNNSIERINSTDRLEAELVLQVLCVGNLYNPDVRYSFNIPIEER
SNLFSWDPYGPWQDCTKMCQGLHRRKIACVRKSDHAVVSDHNCGHLPMPLFVTEKCNMDC
ELRWHIIGKSDCSSQCGQGYRTLDVHCMKYSVHKGQAVPVGDQYCGDQLKPPSREPCHGS
CVLTRWHYSEWSQCSRSCGGGDKTRESYCVNGFGHRLAESECRELPRVVLENCNEFPCPS
WATSEWSECPVTCGKGMKQRQVWCQLSEDPMRDGFCNASTKPESLRPCELRACASWHVGP
WGSCTATCGHGYQMRAVKCISEIFGTMLDDRECPQASRPSDRQDCILAPCLAIPEVGATS
LPAIPLGRAAQWRHGSWTPCSVSCGRGSQARYVSCRDAHDEVADESNCAHLPRPAAVSLC
FSPCGEWQAGDWSPCSASCGHGKTTRRVLCVNYHQLVDESYCDPEGRPVTEQECSLAACP
PLYSRAPSSSEQPSHVPSRNVPLTHKPGENQDQGAQLSIRGNQWRTGPWGACSRSCAGGL
QHRAVVCQDEDGRSATSCDGSSKPPESRHCGSGPCPHWNYGDWGECTQTCGGGVKSRFVI
CQFPNGQMTQEHSCELPKPPSMMQCHLHACPEDVSWYRGPWKSCSASCGKGVKYREVLCI
DQFQRKLEEKYCSHLHKPRTHKACRSGRCPSWKANKWKECSVTCGSGVQQREVYCRLRGT
GRVSEDMCDPSTRPQGQRQCWRQDCMRYQWTTGDWLDCSTSCKKKETYRLVKCVNEQNVQ
ANESLCDPLTKPLSIKKCRNPHCKYSVVTGDSSQCAGNCGFTSPQKITYCTKIQSSKKHT
FHQLRPVVYGECPVIPSPQAYKCDLRSCLHVATWKVGKWSKCSVTCGIGIMERRVACRTE
NGWPSDLCLKRLKPDAQKKCYANDCKLLTTCKELQVTNNVTKDGDYDLNVRGRILKIHCS
GMQLENPREYLPLVKSEDNFSEIYGLRLQNPYECPFNGSRRPDCACENDYLPAGYTVFSK
VRVDLESMQIKTADLLFSQTLSGKAVPFATAGDCYSAARCPQGQFSINLAGTGMKISNTA
KWLAQGRYASVIIHRSQDGTKVYGRCGGFCGKCIPHMATGLSIQVL
NT seq 5721 nt   +upstreamnt  +downstreamnt
atgcgggtggccaagtggctgaccgggttgctctgcccgatctcgctccttctcactggg
tcctgggaagttcgtttccacccacgacaggaagccctggtgaagactctggcctcctac
gaagtggtgacccccacgcgggtcaatgagttcggagacgtgtttccccagaaccggcat
ttcagccggaagaaacgtagctccggggtgccggagcctcctccgttcaggacccactac
cgaatcagcgcctacgggcagctcttccagctgaacctgagcgctgatgcggccttcctg
gctgcaggctacactgaggtgcacttggggaccccggtacctggaccaggcgggcgcagc
acggagtccccagacctgcgccactgtttctaccgtggccaggtcaacgcgcgagaggac
cacactgctgtcttcagtctctgtggaggactgatggggacattcaaagcaaatgatggg
gagtatttcttagaaccagtcctgagggccgatgggagtgcgcatgacgatgaccacaac
aagccacatctgatctacagacaggaattaaagaggaactcctttgcgcggtctcacaag
ccttgtgaagtttcagaaaatcaaatggagaaaactgctttgccctctcagagctccaga
aacacgactggagatgttgatatcgaagaggaagcggtgttcagattggaaggcgaacgg
agccagttacattccaggaataagcgttttttatcatacccaagatacgtggaagttatg
gttacagccgatgctaagatggttcaccatcatgggcagaatttgcagcactatgttctg
acactgatgtcgattgttgctgcaatctacaaggattccagcattgggaaccttatcaat
atagtgattgtgaaattagttgtgattcacagtgaacaggaaggaccagtgatcagtttt
aacgcagccaccacgttacgcaacttttgcttatggcaacagagtcagaatgtcccggat
gatgctcacccctcccaccatgacactgctgtcctcatcactagggaagacatttgcgga
gctaaagagaaatgcgacacgttaggcttagcagagctaggcaccctgtgtgatccttca
cggagctgctccattagcgaagagaacgggctgagcgccgccttcaccatcgcccatgag
cttggacacgtgtttaatgttccacacgacgacagctttaaatgtaaagaagccggaatt
aaacatcagtatcacgtcatggccccgactctaaattaccacacgagtccttggacctgg
tcagcatgcagtcagaagcatatcacagaatttctagacactggtcatggagaatgcctt
cttgacaaacccaacgggagaacatatgacctgtctccacagcttccgggctccgtgtac
gatgggaacaggcagtgtgagctcatgtttggccctggatcacaagtgtgtccctacttg
aagcactgccgacgtctgtggtgcacgagtgcagaaggcgtccacaagggctgtcgcaca
cagcacatgccgctggcagatgggacgagctgtggtcccgggatgcactgccaccgtggg
ctgtgtgtgaccagggacatggagacccgtcctgtggatggcgagtggggaccatgggga
ccctacagctcgtgttcaaggacatgcggaggtggaatcaagagcacagcccggctctgt
gaccggcccgagccacgaaacggaggaaggtactgtgtgggccgcaggatgaaatttcga
tcatgtaatactgattcatgtccaaaaggcaagcgagacttccgagaaaagcaatgctcc
gacttcgacggtaaacatttcgacatcaacggcctcccccccaatgtgaggtggcttccg
aagtacagcgggattgccgtaaaagatcgctgtaaactctattgccgggtcgctgggact
accagcttctaccagctgaaggacagagttgctgatgggacaccctgtgggacggaaact
aacgacatctgtgtccagggcctctgtcggcaagctggctgtgatcacgtgttaaactcc
aaggccaagagagacaagtgtggagtgtgtggtggtgacaactcttcgtgccagaccctg
gcaggtgtcttcaacagtgcccattacggttacaatgtggttgtaaagatccctgcgggg
gctacaaacattgaaatccttcagcacagctattctggaagaccagaagatgacaactat
ctcgcattatctgacactcaagggaactttctcctgaatggaaactttgttgtaagtatg
gcgaagaaagagatcaacatccagggtgctgttttcgaatacagcgggtcaaacaactcg
attgaaagaattaacagcacggaccggctggaggcggagctcgttctgcaggtgttgtgt
gtgggtaatttatacaaccctgacgtgcgctattccttcaacatccccattgaggagagg
agcaatctgttctcctgggatccatacgggccgtggcaagactgtaccaaaatgtgccaa
ggtcttcatagaagaaaaattgcctgcgtccgtaagagcgaccatgcagttgtatctgac
cacaattgtggccacttaccgatgccactgtttgtgactgaaaagtgcaatatggactgt
gaactcaggtggcacatcattgggaaaagcgactgctcatcccagtgtggccaaggatac
agaaccctagacgttcactgcatgaagtactcggttcataaaggacaggctgtcccagta
ggagatcagtactgtggtgaccagctcaagcctcccagccgagagccatgccatggcagc
tgtgttttgacaaggtggcattattcagagtggtcccagtgttctaggagttgtggcggc
ggtgacaagactcgggaatcctactgcgtaaatggctttggccaccgccttgctgaaagc
gagtgtcgggagcttccgcgggtggtgctggagaactgcaatgaatttccgtgtcccagc
tgggcaacgagtgagtggagtgagtgtcctgtcacatgtggaaaaggaatgaagcagcga
caggtttggtgtcagctgagtgaagaccccatgagggatggtttctgtaatgccagtacc
aagcccgagtcgctgagaccctgtgagctccgtgcgtgcgcttcttggcatgtaggaccg
tgggggtcttgcacggccacctgtggacatggatatcagatgcgtgctgttaagtgtatc
agtgagatatttggcaccatgctagatgacagagagtgcccgcaagccagccggccaagt
gacagacaggactgtatattggcaccttgcctggctattccagaagtgggggccacctcc
ttaccagccattcccctgggaagggcagcacagtggcgccatggatcgtggaccccatgc
tctgtgtcctgtggaagaggcagtcaggcccgttatgtgagctgccgggatgctcatgat
gaagtggcagatgagtcgaattgtgcccacttgcctcgacctgctgcggtgtctctctgc
ttcagcccttgtggagagtggcaagcaggggactggtcaccatgttcagcctcctgtgga
catgggaaaaccacccgacgtgttttatgcgtgaactaccaccaactggtcgatgagagt
tactgtgacccggaaggccgtcctgtgactgaacaagaatgtagcctggcagcctgccca
cccttatacagccgagctcccagctcctctgagcagccaagccacgttcccagcagaaat
gttccattaactcacaaaccaggagagaatcaagatcagggggcccagctgtcaatcaga
ggaaaccagtggagaacaggcccttggggagcatgctccagaagctgcgccggtggtctt
cagcacagggctgtggtctgccaggatgaagacgggcgaagcgctacttcctgtgatggg
tcctccaagcccccagagtcaaggcactgtggctccggaccttgtccgcactggaattat
ggggactggggagaatgcacacaaacctgtggtggaggggtaaaatcaagatttgtgatc
tgtcagtttcccaatggccaaatgacacaggaacacagctgtgaactgcccaagccacct
agcatgatgcagtgtcacctgcacgcctgccctgaagatgtgtcctggtatcggggacca
tggaagtcgtgctcagcttcctgtggtaaaggtgtaaagtaccgggaggttctttgtatt
gatcaattccaaaggaaattagaagaaaaatattgcagtcatttgcataaacctcgaact
cacaaagcttgcagatcgggacgatgcccttcatggaaggccaataaatggaaggagtgc
tctgtgacctgtgggtcaggggtgcagcagagggaggtgtactgcaggctgagaggcact
ggtcgagtgtctgaagacatgtgtgatccatccacccggcctcaggggcagcggcagtgc
tggcgtcaggactgcatgaggtaccagtggacgacaggagactggctagattgttcaaca
tcgtgtaagaaaaaagagacctatcggctggtgaaatgtgtgaatgagcaaaacgtacaa
gccaatgaaagtctctgtgaccctttaacgaagccgctttcaatcaaaaaatgcaggaac
cctcactgcaagtactcggtggttacaggagactcgtcgcagtgtgcaggtaactgtggg
ttcacttccccacagaagattacatactgcactaagatccagtcctctaagaagcatacg
ttccatcagcttcggcctgtcgtctatggggaatgtccggtgataccgtctcctcaggcg
tacaaatgcgaccttagaagctgtctgcatgtagccacttggaaagtgggaaaatggagc
aagtgctcagtaacttgtggaattgggataatggagagaagagtagcatgcaggactgag
aacggttggcccagtgacttatgtttaaagcgtttaaagccagatgcccaaaagaaatgt
tatgccaatgactgtaaattactaaccacctgcaaggaactccaagttacaaacaatgtt
accaaggatggtgactatgaccttaacgtcaggggaagaatattgaagatccattgctca
ggcatgcagctggagaaccctagagaatatttaccactggtcaaaagtgaagacaacttt
tcagaaatatacggccttagacttcaaaatccctatgaatgccccttcaacggaagcagg
aggccagactgtgcgtgtgaaaacgactacctacctgccgggtacactgtttttagcaaa
gtgagagtggatctcgaatccatgcaaatcaaaactgcagatcttcttttttcccagaca
ctatctggaaaggcagttccatttgctacagctggggactgctacagcgctgccagatgc
ccacaggggcagttcagcatcaacttagcaggaactgggatgaagatatccaacacagca
aagtggctcgctcaggggaggtatgcctctgtcatcatccacaggtcccaagacggaacc
aaagtctacggcagatgcggagggttctgtggaaagtgcattcctcacatggctacgggg
ctctcaattcaagtactgtga

DBGET integrated database retrieval system