KEGG   Mus musculus (house mouse): 224624
Entry
224624            CDS       T01002                                 
Symbol
Rab40c, RAR3
Name
(RefSeq) Rab40C, member RAS oncogene family
  KO
K07928  Ras-related protein Rab-40
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    224624 (Rab40c)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    224624 (Rab40c)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     224624 (Rab40c)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab40
    224624 (Rab40c)
SSDB
Motif
Pfam: Ras Roc SOCS_box Arf
Other DBs
NCBI-GeneID: 224624
NCBI-ProteinID: NP_631893
MGI: 2183454
Ensembl: ENSMUSG00000025730
UniProt: Q8VHQ4 Q0PD11
Position
17:complement(26101088..26138688)
AA seq 281 aa
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASGAGGSGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgggcacccagggcagtccagtgaagagctacgattacctgctcaagttcctgctggtg
ggcgacagcgacgtgggcaaaggcgagatcctggagagccttcaggacggcgcagctgaa
tccccgtacgcctacagcaacgggatagactataagactaccaccatcctcctggatgga
cggcgtgtcaagctggagctatgggacacatcgggccagggaaggttctgtaccatcttc
aggtcctactcaaggggtgcacagggaatccttctggtgtacgacatcaccaaccgttgg
tcctttgatggcattgaccggtggatcaaggagatcgatgagcatgcacctggtgttccc
cggatcctggttgggaaccggctgcacctggccttcaagcggcaagttccaacggagcag
gccagagcctatgcagagaagaactgcatgaccttctttgaagtcagccccctgtgcaac
ttcaacgtcattgagtccttcactgagctctcccgtatcgtgctcatgcggcatggcatg
gagaagatctggagacccaatcgagttttcagcctgcaggacctctgctgccgtgccatt
gtctcctgtacccctgtgcacctcatcgacaagctcccactacctgtcaccatcaaaagc
cacctcaagtccttttccatggccaacggcatgaacgctgtcatgatgcacggccgctcc
tactccctggcaagtggggccgggggcagtggcagcaagggcaacagccttaagaggtct
aagtccatccggccccctcagagcccacctcagaactgctctcggagcaactgcaagatc
tcctag

DBGET integrated database retrieval system