KEGG   Mus musculus (mouse): 22642
Entry
22642             CDS       T01002                                 

Gene name
Zbtb17, AA589413, Lp-1, Miz, Miz1, Zfp10, Zfp100, mZ13
Definition
(RefSeq) zinc finger and BTB domain containing 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22642 (Zbtb17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22642 (Zbtb17)
   05202 Transcriptional misregulation in cancer
    22642 (Zbtb17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22642 (Zbtb17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22642 (Zbtb17)
   04121 Ubiquitin system [BR:mmu04121]
    22642 (Zbtb17)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    22642 (Zbtb17)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     22642 (Zbtb17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2HC_2 zf-C2H2_6 Zn-ribbon_8 zf-Di19 zf-BED zf-C2HE zinc_ribbon_15 zf_UBZ Packaging_FI HypA DUF3342 XPA_N
Other DBs
NCBI-GeneID: 22642
NCBI-ProteinID: NP_033567
MGI: 107410
Ensembl: ENSMUSG00000006215
Vega: OTTMUSG00000010292
UniProt: Q60821 A6H6B9
Position
4; 4 D3
AA seq 794 aa
MDFPQHSQRVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQDIVTACHTLKSLAEPSST
TGESADASAVEGGDKRAKDEKAAATMLSRLDQARGSSSTGPGRELKEERGGQAESASSGA
EQTEKADAPREPPPVELKPDPTSSMAAAEAEALSESSEQEMEVEPASKGEDGQEEEGAGP
ATVKEEGMHLDNGEPPEENEESAGTDSGQELGMEGQNLRSGTYGDRTESKAYGSIIHKCE
DCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGK
SYRLISLLNLHKKRHSGEARYRCGDCGKLFTTSGNLKRHQLVHSGQKPYQCDYCGRSFSD
PTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNL
KRHLRIHSGEKPYVCTHCQRQFADPGALQRHVRIHTGEKPCQCVICGKAFTQASSLIAHV
RQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHT
GEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEA
LAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDA
NSLAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQMLQAGELVFRPRDGTEGQPTLA
ESPPTAPDCLPPAE
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggatttcccccagcacagccagcgtgtcttggagcagctgaaccagcagcggcaactg
ggcctcctctgtgactgcacctttgtggtggacggcgttgacttcaaggctcacaaggcg
gtgctggcagcttgcagcgagtacttcaagatgctctttgtggaccagaaggacgtggtg
cacctagacatcagtaatgcggcaggcctggggcaggtgctggagttcatgtacactgct
aagctgagccttagccctgagaacgtggacgatgttctggccgtggccagcttcctccag
atgcaggatattgtcacggcctgccacacgctcaagtccctcgctgagccgagcagcacc
actggggagagcgcagacgcctcagctgtggaaggaggagacaagagagccaaagacgag
aaggccgctgccaccatgttgagcaggctggaccaagcaagaggcagctcctccacaggc
ccgggcagagaactcaaggaggagcggggtggccaggcagaaagtgcatccagtggcgca
gagcagacggagaaggcagacgctccccgggagcctccacctgtggagctcaagccggac
cccacaagcagcatggcggctgcagaagccgaagccttatcagagagctcagagcaagaa
atggaagtggagccagccagcaaaggagaagacggacaagaggaagagggtgcagggcct
gccacagtcaaggaagaggggatgcatctggataacggggagcctcctgaggagaatgaa
gagtctgccggcacagattctgggcaggagcttggcatggagggtcagaacctgcgctcg
ggcacctacggggatcgcactgagtccaaggcttacggctccatcatccacaagtgcgag
gactgcgggaaggagttcacgcacacagggaacttcaaacggcacatccgcatccacacg
ggggagaaacctttctcatgcagggagtgcagcaaggctttctcggaccctgcagcgtgc
aaggctcatgagaagacacacagcccgttgaaaccctatgggtgtgaggagtgtggcaag
agctacaggctcatcagcctgctgaacctgcataagaagaggcactccggggaggcgcgc
taccgctgcggggactgtggcaagctcttcaccacttcaggcaacctcaagcgccaccag
ctggtacacagtggccagaaaccctaccagtgcgactactgtggccgctccttctctgac
cccacctctaagatgcgccacctggagactcacgacaccgacaaggaacacaagtgtcct
cactgcgacaaaaagttcaaccaggtggggaacctgaaggcccacttgaagatccacatt
gccgatggccctcttaagtgccgggagtgcgggaagcagttcaccacctcagggaacctc
aagcggcacctgcggatccacagtggggagaagccgtacgtatgcacccactgtcagcgg
cagtttgccgacccaggcgcgctacagcggcacgtccggatccacacgggtgagaagccg
tgccagtgtgtgatatgtggtaaggcctttacccaagccagctccctcatcgcccatgta
cgccaacacacgggggagaagccctacgtctgtgaacgctgtggcaagagatttgtccag
tccagccagttggccaaccacatccgtcaccatgacaacatccgaccgcacaagtgcagc
gtgtgtagcaaggccttcgtgaatgtgggggacctgtccaagcacattatcatccacacc
ggagagaagccttatttgtgtgacaaatgtggccgtggtttcaaccgggtagacaacctg
cgttctcatgtaaagaccgtgcatcagggcaaggcgggcatcaagatcctggagccagaa
gagggtggtgaggtcagcgtggtcactgtggacgacatggtcaccctggccactgaggct
ctggcagcgacagcggtcactcagctaacagtggtaccagtgggggccgcagtgacagct
gacgagacggaagtactcaaagctgagatcagcaaagctgtcaagcaagtgcaggaagaa
gaccccaacacccacatcctctacgcttgtgattcctgtggggacaagttcctggatgcc
aatagcctagcccagcatgttcggatccacacagcccaggcactggtcatgttccagacg
gatgcggacttctaccagcagtatgggccaggcagcacgtggccagccgggcagatgctg
caggctggagagctcgtcttccgtcctagggatgggactgagggccaacccacactggca
gaaagtccacccacagctcctgattgcctaccacctgccgagtga

DBGET integrated database retrieval system