KEGG   Mus musculus (mouse): 229055
Entry
229055            CDS       T01002                                 

Symbol
Zbtb10, 4832414A18, AU021107, RINZF
Name
(RefSeq) zinc finger and BTB domain containing 10
  KO
K10497  zinc finger and BTB domain-containing protein 10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    229055 (Zbtb10)
   04121 Ubiquitin system [BR:mmu04121]
    229055 (Zbtb10)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    229055 (Zbtb10)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     229055 (Zbtb10)
SSDB
Motif
Pfam: BTB zf-H2C2_5 zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3342 Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 229055
NCBI-ProteinID: NP_808328
MGI: 2139883
Ensembl: ENSMUSG00000069114
Vega: OTTMUSG00000033722
UniProt: E9Q8X5 Q8BNK5
Position
3; 3 A1
AA seq 861 aa
MSFSEMNRRTLAFRGGGLVTGGGGPTNNNAGGEASSWPPQPQPRLPAPPAPQQPNGRGAD
EEMELEGLEPQDSEAAAGAAAAEDVKELLLLPQDTGGPSLLGGGAGGPLLAERNRRTLAF
RGGGGGGLGNNGSSRGRPETSAWPLRHFNGRGPAAVDPELDALEGKEWMQDGASLSYSTE
EEGASPGDGSGAEGGSCSSSRRSGGDGGDEAEGSGVGAGEGETVQHFPLARPKSLLQKLQ
CSFQTSWLKDFPWLRYSKDTGLMFCGWCQKIPEDGGGVDLTQVGHDELSRGTRNYKKTLL
LRHHVSTEHKLHEANAQESEIPSEEGYCDFNSRPNENSYCYQLLRQLDEQRKKDILCDVS
IVVSGKIFKAHKNILVAGSRFFKTLYCVSNKESPNQNNTTHLDIAAVQGFSVILDFLYSG
NLVLTSQNAIEVMTVASYLQMSEVVQTCRNFIKDALNISIKSEAPESVVVDYNNRKPVSR
DSLPSSSREQKIASFWATRNLTNLASNIKTENEGCDVDEGQVENYQMNDSNWIRDGSPEL
AENESQGKTKVFIWNNMTSQETGKARRKNQTTKRFVYNIPPNSETKVEDCSVMQPPAAYP
EESKALLIKEEPDLDGALLSGPDGDRTMNTNLLAEACSGQDAGDAGASHDFKYGLMPGTS
SDFKYGLLPSTSNDFKFGLLPGASNDFKYGLLPESWPTQETWENGDSSLIMNKLKCPHCS
YVAKYRRTLKRHLLIHSGVRSFKCEICGKMFTRREHVKRHSLVHKKDKKYKCMVCKKIFM
LAASVGIKHGSRRYGVCMDCVDKSQPGGQEVVNQGQDTEFPRDEEYEENEGGEPDEELAE
DGQDENDAPRWDESGGVYVSG
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgtcgttcagtgagatgaaccgcaggacgctggcgttccgaggaggcgggttggtcacc
ggcggcggcggccccacgaacaataacgctggcggggaggcctcttcttggcctccgcag
ccgcaaccgcgactgcccgcgccgcccgcgccgcagcagccgaatgggcgcggggccgac
gaggaaatggaattggagggcctggagccccaggactcggaggccgccgccggcgcggcc
gccgccgaggacgtcaaggagttgctgctgctccctcaggacacgggcggcccctccttg
ctgggcggcggcgcggggggccccctgctagcggaaaggaaccgtcggactctggccttc
cgcgggggaggcggcgggggtctcggcaacaatggcagcagccgcggccgcccggagacc
tcggcgtggcccctcaggcatttcaatgggcgagggccggcggccgtggatccggagctg
gacgcgctggaggggaaggagtggatgcaggacggggcgtccctgagctacagcaccgag
gaggagggggcgagcccgggcgatggcagtggggcggaaggcggcagctgcagcagcagc
aggcggtcgggcggcgatggtggggacgaagcggagggcagcggtgtgggagctggcgaa
ggagagactgtccagcacttcccgctcgcgaggcccaagtccctcttgcagaagctccag
tgctccttccagacctcttggctcaaggacttcccttggctgcggtactccaaggatacc
ggccttatgttctgcggatggtgccaaaagatccccgaggatgggggcggcgtggacctt
acccaggtggggcatgatgagctttcgcgagggacccgcaactacaagaaaaccctgctc
ctaaggcaccacgtctccaccgaacacaaactccacgaagccaacgcccaggagtcagaa
ataccatcagaggaggggtactgtgactttaatagcaggccaaatgagaactcttattgc
tatcaacttcttcgacaactagatgaacagagaaagaaagatattctttgtgatgtcagc
attgtggtgagcgggaaaatctttaaagctcataagaacatcctggttgcaggcagccgt
ttctttaagactttatattgtgtttcaaacaaagaaagccctaaccaaaacaatactacc
cacttagatattgctgcagttcaaggtttttcagtcatcttggacttcctgtattctggg
aacctggtgctcacaagccaaaacgccattgaagtgatgacagtggctagctaccttcaa
atgagtgaagtcgttcaaacttgcaggaatttcattaaagatgccttaaatatcagcatt
aaatcggaagctccggagtctgtggttgtggactataacaataggaagccagttagcagg
gacagcctgccttcatcctcacgggaacagaagatcgccagcttctgggcaacgcggaac
ctgaccaacttggcaagtaatataaaaactgaaaacgaaggctgtgatgtcgacgagggc
caagtagaaaactaccagatgaatgacagtaactggatccgggatggctctcctgaattg
gctgaaaatgaatctcaaggtaaaacaaaagtgtttatttggaataatatgacctctcaa
gagactggcaaagcaaggaggaaaaaccaaactacaaagagatttgtttataatataccg
cctaacagtgagacaaaggtagaagattgctcagtgatgcagccccctgctgcctaccca
gaagaaagcaaggccttactcatcaaggaagagccagatttggatggtgcactactctca
gggcctgatggtgataggaccatgaacacaaatttattggctgaagcctgcagtggtcaa
gatgctggggatgctggagcatcacatgatttcaagtatggtttgatgcctggcacttca
agtgatttcaagtatgggttgctaccaagtacttcaaatgacttcaaattcggattgcta
ccgggtgcttcaaatgatttcaagtatggattattgccagaatcttggcccacacaagaa
acgtgggaaaatggtgactcatctctaatcatgaacaagttgaaatgccctcattgtagc
tatgtagccaaatacaggcgaacactaaaaaggcacttgctcattcattctggagtaaga
tcatttaagtgtgaaatttgtggaaagatgtttactagaagagaacacgtaaaaagacat
tccctggtacataaaaaggataaaaaatacaaatgcatggtgtgtaagaagatcttcatg
ttagcagccagtgttggaataaaacatggttctcgacgctacggagtatgcatggactgt
gtagataagtcacagccaggaggacaagaagttgtaaatcagggacaagatacagagttc
cctcgggatgaagagtacgaggaaaacgaaggtggcgagcccgatgaggagctggctgaa
gacggacaagatgaaaacgatgcacctcgatgggatgagtcaggaggcgtttatgtctct
ggatga

DBGET integrated database retrieval system