KEGG   Mus musculus (mouse): 232879
Entry
232879            CDS       T01002                                 

Symbol
Zbtb45, BB161562, Gm157, Zfp499
Name
(RefSeq) zinc finger and BTB domain containing 45
  KO
K10516  zinc finger and BTB domain-containing protein 45
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    232879 (Zbtb45)
   04121 Ubiquitin system [BR:mmu04121]
    232879 (Zbtb45)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    232879 (Zbtb45)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     232879 (Zbtb45)
SSDB
Motif
Pfam: BTB zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2H2_11 Zn-ribbon_8 zf-C2H2_2
Other DBs
NCBI-GeneID: 232879
NCBI-ProteinID: NP_001019870
MGI: 2685003
Ensembl: ENSMUSG00000049600
Vega: OTTMUSG00000060867
UniProt: Q52KG4
Position
7; 7 A1
AA seq 520 aa
MAATEAVHHIHLQNFSRSLLETLNGQRLGGHFCDVTVRIREASLRAHRCVLAAGSPFFQD
KLLLGHSEIRVPPVVPAQTVRQLVEFLYSGSLVVAQGEALQVLTAASVLRIQTVIDECTQ
IIARARVPNTPAPAPLPPPVPPPLAPAQLRHRLRHLLAARPPGHPNAAHSRKQRQPARLQ
LPAPPAPIKAEGPDAEPALTAAPEDRGEEDDDEETDEETDAEEGEGGGGGPGEGQAPPAF
PDCAGGFLTTAADSAREDPPASTGITDYGGAGRDFLRGTGVTEDVFPDSYVSAWHEESSG
GPESCPVETSAPPDCALAGPRPTGVKTPGPPVALFPFHLGAPGPPAPTPPTPSGPAPAPP
PTFYPTLQPDAAPSAQLGETQAVPAAPAAQATAISGTPVRAPGGQGAEQPAYECSHCRKT
FSSRKNYTKHMFIHSGEKPHQCAVCWRSFSLRDYLLKHMVTHTGVRAFQCAVCAKRFTQK
SSLNVHMRTHRPERAPCPACGKVFSHRALLERHLAAHPAP
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcagccacagaggcagtgcaccacatccacctacagaacttttcgcgctcactactg
gagaccctcaatgggcagaggctaggcggtcacttctgtgatgtgaccgtgcgcatccgt
gaggcttctctgcgtgctcaccgctgtgtgctggccgctggctcacccttctttcaggat
aaactgctgctcggccactcagagattcgtgtgccaccagtggtgcctgcgcagacagtg
cgccagctggtcgagttcctttacagcggctcgttggtggtggcacagggcgaagcgctg
caggtactcactgcagcgtcggtgcttcgcatccagaccgtcattgacgagtgcacacag
atcatcgctcgtgcccgtgtccccaacaccccggcgcctgcgcctctgccaccacccgtg
ccccctccactagcacccgcgcagctgcgccaccgtctgcgccacttgctggccgcccgc
cccccgggtcatcccaacgccgcgcacagccgcaagcagcgccagcccgcgcgtcttcag
ctacctgcacccccagcacccatcaaggctgaggggcctgatgcggagccagcgctgact
gccgcgcctgaagacagaggtgaagaggatgacgatgaggaaacggatgaagaaaccgac
gctgaagaaggtgaaggaggcggcggcggcccgggtgagggccaggctccccctgccttc
cccgactgtgcagggggcttccttaccactgcagctgacagcgctcgagaggatccccct
gcatccactggcatcactgattatggtggtgccgggagagatttccttcgggggactggg
gtcactgaagatgtgttcccagatagttatgtgtccgcttggcatgaggaaagcagcgga
gggccagaaagttgtccggtggaaacgtctgctccacccgactgtgccctggctgggcct
cgcccaacaggtgtgaagaccccagggccccccgtggctctctttccctttcacttgggt
gctcccggccccccagcgccaacacctcctactccatctgggccagcccctgcacccccg
cccaccttctaccccacgctccagccagatgcagcccccagtgctcagctgggagaaacg
caggcggtgccagcggcccctgccgctcaggccacagccatctctggcactcctgtgcgc
gccccgggtggccaaggtgctgagcaacccgcctatgagtgtagccactgccgcaagacg
ttcagctcgcggaaaaactacaccaagcacatgttcatccactctggggagaagccacat
cagtgcgctgtgtgttggcgatccttctcgctacgcgattacctgctcaagcatatggtc
acacacactggcgtgcgagccttccagtgtgcagtgtgtgccaagcgcttcactcagaag
agctccctcaacgtgcacatgcgcacacataggcctgagcgtgcgccctgccctgcctgt
gggaaagttttctcacaccgtgcactgctggagcgacaccttgcagctcaccctgcacct
tga

DBGET integrated database retrieval system