KEGG   Mus musculus (house mouse): 235320
Entry
235320            CDS       T01002                                 
Symbol
Zbtb16, AI467657, PLZF, Zfp145, lu
Name
(RefSeq) zinc finger and BTB domain containing 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    235320 (Zbtb16)
   05202 Transcriptional misregulation in cancer
    235320 (Zbtb16)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    235320 (Zbtb16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    235320 (Zbtb16)
   04121 Ubiquitin system [BR:mmu04121]
    235320 (Zbtb16)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    235320 (Zbtb16)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     235320 (Zbtb16)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-met zf-C2H2_6 zf-C2H2_jaz zf_UBZ zf-C2H2_2 Endonuclease_7 zf-C2H2_11
Other DBs
NCBI-GeneID: 235320
NCBI-ProteinID: NP_001028496
MGI: 103222
Ensembl: ENSMUSG00000066687
UniProt: Q3UQ17
Position
9:complement(48563097..48747525)
AA seq 673 aa
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMADGGGEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMSIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKMEMMQVDEAPGQDSPGAAESSISGGMGDKLEERSKEGPGTPTRGSVITSARELHYGRE
ESGEQLSPPVEAGQGPPGRQEPLAPPVEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKAESRPLGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggatctgacaaagatggggatgatccagctgcagaaccctagccaccccacggggctg
ctgtgcaaggccaatcagatgcgactggctgggactttgtgcgatgtggtcatcatggtg
gacagccaggagttccatgcccaccggacggtgctagcctgcaccagcaagatgtttgag
atcctcttccaccgaaacagccagcactatactctagacttcctctcgccaaaaaccttc
cagcagatcctggagtacgcctacacggccacactgcaagccaaggcggaggacctggat
gacctgctgtatgcagctgagattttagagatcgaatacctggaggagcagtgcctgaag
atcctggagaccatccaggcatctgatgacaatgacacagaggccaccatggctgacggt
gggggcgaagaagaagaggaccgtaaggctcgatacctcaagaacatctttatctcgaag
cattccagcgaggagagtggctacgccagtgtggctggacagagcctccctgggcccatg
gtggaccagagcccctcagtctccacctctttcggtctctcagccatgagtcctaccaag
gcagccgtggacagcttgatgagtataggacagtcactcctgcaaggaactcttcagcca
cctgcagggcctgaggagcccacactggcagggggtgggcgacaccctggggtggctgag
gtgaagatggaaatgatgcaggtagatgaagcccctggccaggacagccctggggcagct
gagtctagcatctcaggagggatgggggacaagcttgaagagaggagcaaagaggggcct
gggaccccgactcgaggcagtgtcatcactagtgccagagagctgcattatgggagagag
gagagtggtgagcagctctcgcctcctgttgaagctggccagggaccccctgggcggcag
gagcccctggcacccccagtggagaagcatttgggtatctactcggtgctgcccaaccac
aaggccgatgctgtgttgagcatgccgtcttcagtgacgtccggtctccatgtgcaacct
gccctggcagtctccatggacttcagcacctacgggggtctgctgcctcagggcttcatc
cagagggagctgttcagcaagctgggggagctggctgtgggcatgaaggctgagagccgc
cctctgggggagcagtgcagcgtgtgtggggtcgagcttccggacaacgaggcagtggag
cagcacaggaaactgcacagtgggatgaaaacatacgggtgtgaactctgcggaaaacgg
ttcctggacagtttgcgactgagaatgcatttactggctcattcagcgggtgccaaagcc
tttgtgtgtgatcaatgcggtgcccagttctcaaaggaggatgccctggagacacacaga
cagacccatactggcacggacatggctgtcttctgtctgctgtgtgggaaacgctttcag
gcacaaagcgcactccagcagcacatggaggtccacgcaggcgtgcgcagctatatttgc
agtgagtgcaaccgcaccttccccagccacacggctctcaagcgccaccttcgctcacat
acaggtgaccacccatatgagtgtgagttctgcggcagctgcttccgggatgagagcaca
ctcaagagccacaagcgcatccacacaggggagaagccctatgagtgtaatggctgtggc
aagaagttcagcctcaagcaccagttggagacgcactacagggttcacacaggtgagaag
ccctttgagtgcaaactctgccaccagcgctcccgagactactcggccatgatcaagcac
ctgagaacacacaacggtgcctcgccataccagtgtaccatctgcacggaatactgcccc
agcctctcctccatgcagaaacacatgaagggccacaagccggaggagatcccacctgac
tggaggatagagaagacgtacctctacctgtgttatgtgtga

DBGET integrated database retrieval system