KEGG   Mus musculus (mouse): 240322
Entry
240322            CDS       T01002                                 

Gene name
Adamts19, 4831407I23Rik, AU015154, D230034E10Rik
Definition
(RefSeq) a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 19
  KO
K08633  a disintegrin and metalloproteinase with thrombospondin motifs 19 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    240322 (Adamts19)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     240322 (Adamts19)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   240322 (Adamts19)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_spacer1 TSP_1 Reprolysin ADAM_CR_2 Pep_M12B_propep TSP1_spondin Reprolysin_5 TSP1_CCN Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M10 PLAC DUF4309
Other DBs
NCBI-GeneID: 240322
NCBI-ProteinID: NP_780715
MGI: 2442875
Ensembl: ENSMUSG00000053441
UniProt: P59509
Position
18; 18 D3
AA seq 1210 aa
MGPEMRLTRICCCCCLLYQLGFLSHGTTSGLQLTPDLEEWEVVFPALWRRESLNATGLSG
GSSDPGSGRSSGGGGRGQASGSSREVRSVARAPQEEATRGQSEPWFGSPLEPGAEDEEEL
ESQELPRGSSGDTALSSGTPASWQPPLPPQRPSSPPPAQQEEPSAEEVLLRIPALSRDLY
LLLRRDGRFLAQRFAVEQWPKPGPDPTRATADPGSSLLPDASCFYTGTVLRHPGSLASFS
TCGGGLMGFIQLNEDFLFIEPFNDTMAIIGHPHRLYRQKRSTEEKVTENSAVHRHHCGVI
SDKGRPRSKKIADNRREKRYSYKLSQEYNIETVVVADPAMVSYHGADAARRFILTILNMV
FNLFQHKSLGVQVNLRVLKLILLHETPADLYIGHHGEKMLESFCKWQHEEFGRRNDVHLE
MSTSWGEDIAAVDAAILITRKDFCVHKDEPCDTVGIAYLNGMCSEKRKCIIAEDNGLNLA
FTIAHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKA
SSCLLHTDPQSLSSVLVPSKLPGMAYTADEQCQILFGPLASFCQEMQHVICTGLWCKVEG
EAECRTKLDPPMDGTDCDPGKWCKAGECTRRTPAPEHLAGEWSPWSSCSRSCSSGVSSRE
RKCPGLGSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSYPKHALQWQAVF
DEEKPCALFCSPVGKEQPVLLSEKVMDGTSCGYQGLDICANGRCQKAGCDGLLGSLARED
HCGVCNGNGKSCKVIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPAHSFLALRDASKQ
SINSDWKIEHSGAFSLAGTTVHYLRRGLWEKISAKGPTTTPLHLLVLLFQDQNYGLHYEY
TVPSDPLPDNQSSKEPGPLFMWTHAGWGDCNATCGGGERKTMVSCTKIMSKNISLVDNKK
CKDLTKPEPQIRKCNEQPCQTRWMMTEWTTCSRTCGKGVQSRQVACTQQLENGTLIRAWE
RDCLGPKPATVQRCEGQDCMTVWEAGVWSECSVKCGKGVRHRTVRCTNPRKKCVLSTRPR
EAEDCEDYSKCYVWRVGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRP
CHLQPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRD
FYAQKLQQKS
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgggcccggagatgcgcctgactcgcatctgctgctgctgctgcctcctctaccagcta
ggcttcctgtcgcatgggaccacctcagggttgcagctcaccccggatctcgaggaatgg
gaagtcgtgtttcctgcactctggcgccgggagtcgctgaacgccacgggcctcagcggg
ggcagctcagacccgggatccgggcgcagctctgggggcggcggccgggggcaggcttcg
ggcagctcgcgggaggtgcgctcggtggcccgagcaccgcaggaagaagccaccagaggc
caatctgagccctggttcgggtctcccctggagccaggtgctgaggacgaggaggaactc
gaatctcaggagctgcctcggggatccagcggagatactgccctgtcctcgggaaccccg
gcctcgtggcagcctcctctgcccccgcaacggccctcgtccccgccccctgcccagcaa
gaggaacccagcgcggaggaggtgctgttgcggatcccggccctctcccgggacctgtac
ctgctgctccggagagatggccgcttcctggcgcagcgcttcgcagtggagcagtggccc
aaaccaggtcccgatcccacccgggcaacggctgaccctggctcttccttgctgccagat
gcctcctgcttttacaccgggacagtgctgcgccatcctggctctctggcctctttcagc
acctgtggaggtggcctgatgggctttatacagctcaatgaggacttcctattcattgag
ccattcaatgatacaatggccatcataggtcacccgcaccgtttatacaggcagaagagg
tccacagaggaaaaagtaacagagaactcagctgttcaccgccatcactgtggtgtcatt
tcagataaaggaagaccaaggtctaaaaaaatagcagacaacagacgagaaaaacggtat
tcctacaaattatcccaggaatacaacatcgagaccgtagtagttgcagaccctgcaatg
gtttcctaccacggagcagatgcagccaggagattcattctgacaatcctaaatatggtt
tttaaccttttccagcacaagagtctgggtgtgcaggtcaacctccgtgtgctaaagctc
attctcctccatgaaacaccagcagatctgtatattgggcaccacggagagaaaatgctg
gagagtttttgtaagtggcagcacgaagagtttggccggaggaatgatgtgcatttggag
atgtcgaccagctggggagaagacattgctgcggtggatgcagctattcttataacaagg
aaagatttctgtgtgcacaaagatgagccatgtgacactgtgggtattgcttacttgaat
ggaatgtgtagtgaaaagaggaagtgtattattgctgaagacaacggcctgaaccttgcg
tttacaatcgctcatgaaatgggtcacaacatgggcatcaaccatgacaatgaccaccca
tcctgtgctgatggtcttcatatcatgtctggtgaatggatcaaaggacaaaatcttggt
gatgtttcatggtccaggtgcagcaaggaggatctggaaagatttctcaggtcaaaggcc
agtagctgcttgttgcatacagatccgcagagtctcagttcggtgctggttccctcaaaa
ttgccagggatggcttacactgcagacgaacagtgccagatcctctttgggcctctggct
tctttttgtcaagagatgcagcatgttatctgcactggtttgtggtgcaaagtggagggg
gaagcagagtgcaggaccaagctggacccaccaatggatgggactgactgcgaccctggc
aagtggtgtaaggctggagaatgcacccgcaggactcctgcacccgagcacttggctgga
gagtggagcccgtggagttcctgtagtcgaagttgcagttctggggtcagcagtcgagag
cgcaagtgtcctgggctaggttctgaagcaagggattgtaatggccccagaaaacaatac
agaatatgtgagaatccaccttgtcctgcaggtttgcctggattcagagactggcaatgt
caggcctatagtgttagaacttcgtacccaaagcatgcacttcagtggcaagctgtcttc
gatgaagaaaaaccatgtgccttgttttgctctcctgttggaaaagaacagcctgttctt
ctatcagaaaaagtgatggatggaacttcttgtggatatcagggactagatatatgtgca
aatggcaggtgccagaaagctggttgtgatggtttactggggtctcttgccagggaagat
cattgtggtgtttgtaacggcaatggaaagtcatgcaaagtcattaaaggcgattttaat
cacaccagaggggcaggttatgtagaagttctggtgatacctgctggagcgagaagaatc
aaagttgtggaggaaaagccggcacatagcttcttagctcttcgagatgccagtaagcag
tctataaacagtgactggaagatagaacattctggagcattcagtctggctggaactaca
gtacattacttaagacgaggcctgtgggagaagatctctgccaaaggtcccacaaccaca
cctttgcatctcctggtactcctatttcaagatcagaattacggtcttcactatgaatat
actgttccatcagaccctcttccagacaatcagagttctaaggagccggggcccctcttc
atgtggacacacgcaggctggggcgattgcaatgccacgtgtggaggaggagagaggaag
acaatggtgtcctgcacaaaaatcatgagcaagaatatcagccttgtggacaacaagaaa
tgcaaggacttgaccaaaccagagccacagattcgaaagtgcaatgaacaaccttgtcaa
acaaggtggatgatgacagaatggaccacgtgttcacgaacctgtggaaaaggagtccag
agtagacaagtggcctgtacccagcagctggaaaatggaaccctgattagagcctgggag
agggactgcctagggccaaagcccgcaactgtgcaacgctgtgagggtcaggactgcatg
acggtgtgggaggccggagtgtggtcggagtgctcagtgaagtgtggcaaaggtgtgcgg
catcgcaccgtgaggtgcactaacccgagaaaaaagtgcgtcctctccaccagacccagg
gaggccgaggactgtgaggattactccaaatgctacgtgtggcgagtaggtgactggtct
aagtgctccattacctgtggcaaaggcatgcagtctcgtgttatccagtgcatgcataag
atcacaggaagacacggaaatgaatgcttttcttcggagaaacctgcagcctacaggcca
tgtcaccttcagccctgtaatgagaaaattaatgtaaatacaataacatcaccaagactg
gctgccctgaccttcaagtgcctgggagaccagtggccagtgtactgcagagtgatccgg
gagaagaatctttgccaggacatgcggtggtaccaacgatgctgtgagacttgcagggac
ttctatgcccaaaagctacagcagaagagttga

DBGET integrated database retrieval system