KEGG   Mus musculus (house mouse): 240869
Entry
240869            CDS       T01002                                 
Symbol
Zbtb37, D430004I08Rik
Name
(RefSeq) zinc finger and BTB domain containing 37
  KO
K10509  zinc finger and BTB domain-containing protein 37
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    240869 (Zbtb37)
   04121 Ubiquitin system [BR:mmu04121]
    240869 (Zbtb37)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    240869 (Zbtb37)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     240869 (Zbtb37)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 KLHL33-like_BTB_POZ SANBR_BTB zf-met zf-C2H2_jaz zf-C2H2_2 BTB_2 zf-H2C2_5 zf-C2H2_6
Other DBs
NCBI-GeneID: 240869
NCBI-ProteinID: NP_001343418
MGI: 2444467
Ensembl: ENSMUSG00000043467
Position
1:complement(160830492..160862432)
AA seq 504 aa
MTMEKSGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFR
DHMSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKC
TQILEGIHFKINVAEVEAELSQTRTKHQERPPESHRATPNLNRSLSPRHNASKGNWRGQV
SAVLDIRELSPPEEPTSPQIIEQSSDAEGREPILRINRAGQWYVETGLADQGARSGDEVR
VLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
ARPTSSEVDRFSPSGSVVSMTERHRARSESPGRMDEPKQLSSQVEESAMMGVSAYVEYLR
EQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEY
HIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTSRQAEEG
SPSHEEIVAPGESAQGSVSTTGPD
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgaccatggagaaaagtgggaacatacaattggagatccccgacttcagcaactctgtt
ctgagccatctcaaccagctacgaatgcaaggccggctctgtgatattgtggtcaatgtg
caaggacaagcttttcgggctcacaaagtagtactggctgccagctccccttatttccgg
gatcacatgtccttgaatgaaatgagtactgtgtccatttctgtcatcaagaaccctact
gtttttgagcaacttctttctttctgttacacagggcggatatgcctgcaactagcagat
atcatcagctacctaacagctgctagttttctgcagatgcagcatattatagacaaatgt
acgcagatcctagagggcattcacttcaaaattaatgtggctgaggttgaagcagaatta
agtcaaacaaggacaaagcatcaagagagacctccagagtctcatagggctacaccaaat
ctaaaccgctcacttagtccacggcataatgcctcaaagggaaactggagagggcaggtc
agtgccgtgctggatatccgagagctcagtcccccggaggagcccaccagtcctcagata
attgaacagagttctgatgcagaaggccgggagcccattcttcgaatcaacagagcagga
cagtggtatgtggaaacaggactagcagaccagggggcccggagtggtgacgaagttagg
gttcttggagcagtgcacatcaaaactgaaaatctagaagagtggcttgggccagagaat
cagccttctggagaagatgggagtagtgcagaggaagtcacagccatggtgattgacacc
acaggccatggttctataggacaggaaagttatactttagggtcttcaggagccaaggta
gctcggccaaccagcagtgaagttgacagatttagtccctccggcagtgttgtttccatg
acagaaagacacagagccagaagtgagtctcctgggagaatggatgagcctaagcaactt
agctcccaggtagaagagtcagcaatgatgggagtaagcgcctatgtggagtatctccga
gaacaagaagtgtccgaacgatggttccggtataatccccgtctcacctgcatctactgt
gccaaatctttcaaccaaaagggaagtctggaccgccacatgcgcctgcatatgggaatc
acaccgtttgtctgccgcatgtgtggaaaaaagtatacccggaaagaccagctggaatat
cacatccgcaagcacacaggcaacaagccctttcactgtcacgtttgtggcaaaagtttc
cccttccaggccatcttgaatcagcactttcgaaaaaaccaccctggttgtatacccctg
gaagggcctcatagcatttctcctgagactactgtcacttcccggcaagctgaagaaggg
tcaccttcacacgaagaaatagttgctcctggagaatctgcccagggctcagtttctact
actgggccagattga

DBGET integrated database retrieval system