KEGG   Mus musculus (house mouse): 28105
Entry
28105             CDS       T01002                                 
Symbol
Trim36, D18Wsu100e, haprin
Name
(RefSeq) tripartite motif-containing 36
  KO
K12013  tripartite motif-containing protein 36 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    28105 (Trim36)
   04121 Ubiquitin system [BR:mmu04121]
    28105 (Trim36)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     28105 (Trim36)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    28105 (Trim36)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    28105 (Trim36)
SSDB
Motif
Pfam: zf-B_box COS fn3 zf-RING_UBOX zf-C3HC4_4 SPRY zf-C3HC4 zf-C3HC4_2 zf-C3HC4_3 zf-RING_5 DUF1319 ATP-synt_B Trm112p
Other DBs
NCBI-GeneID: 28105
NCBI-ProteinID: NP_849203
MGI: 106264
Ensembl: ENSMUSG00000033949
UniProt: Q80WG7
Position
18:complement(46298367..46345674)
AA seq 729 aa
MSESEEISEFGYIMELLAKGKVTIKNIEKELICPACKELFTHPLILPCQHSVCHKCVKEL
LLSLDDSFNDVASDSSNQSSPRLRLTSPSMDKIDKINRPGWKRNSLTPRPTTFPCPGCEH
DVDLGERGVSGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIYHPWGTVKAQHEYVGPTTNFRPKVLMCPEHETERINMYCELCRRPVCHLCKLGGN
HSNHRVTTMSSAYKTLKEKLSKDIDFLIGKESQVKSQISELNLLMKETECNGERAKEEAL
AHFEKLFEILEDRKSSVLKAIDASKKLRLDKFHTQMEEYQGLLENNGLVGYAQEVLKETD
QSCFVQTAKQLHLRIQKATESLKSFRPAAQASFEDYVVNISKQTEVLGELSFFSSGIDIP
EINEEQSKVYNNALIDWHHPEKDKADSYVLEYRKINRDEEMISWNEIEVHGTSKVVSNLE
SNSPYAFRVRAYRGSICSPCSRELILHTPPAPVFSFLFDEKCGYNTEHLLLNLKRDRVES
RAGFNVLLAAERIQVGHYTSLDYIIGDVGVTKGKHFWACRVEPYSYLVKVGVASSDKLQE
WLRSPRDAASPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPTSSNEPENRV
LPMPTSIGIFLDCDKGKVSFYDMDHMKCLYERQVDCSHTMYPAFALMGSGGIQLEEAITA
KYLEYEEDV
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtcggaatcagaggagataagtgaatttggctacattatggaattgcttgccaagggc
aaggtgactattaagaatatcgaaaaggagcttatttgcccagcgtgcaaggagctgttt
acccacccgctgatccttccctgccagcacagcgtctgtcataagtgtgtgaaagaactt
ttactgtctcttgatgactcgttcaatgatgtggcgtcagacagctcaaatcagagcagc
cctaggctccggctcacctcccctagcatggataaaatcgacaagattaacagaccaggc
tggaagcgtaattcactgaccccgagaccaaccacgttcccttgtcctggctgtgaacat
gatgtggatcttggagagcgaggagtcagtggtctgtttcgaaatttcactttggaaacg
attgtcgagagataccggcaggccgctagggcagccacagccattatgtgtgacctttgt
aaacctccaccccaggaatctacaaagagctgcatggattgtagtgcaagctactgcaat
gaatgcttcaaaatttatcatccctggggcactgtaaaagcccagcatgagtatgtgggc
cccaccactaatttcagacccaaggttctaatgtgcccagaacatgagacagagagaata
aacatgtactgtgaactatgcagaaggccagtttgccacctctgtaagttgggtgggaat
cattccaatcaccgggtaaccaccatgagcagtgcctacaaaaccttaaaggagaaactt
tcaaaagacattgatttccttattggcaaggaaagccaggtgaagagtcaaatttctgaa
ctaaacttgctaatgaaagagacagagtgcaacggagagagggcgaaggaagaagcgctg
gcgcattttgaaaagctctttgaaatcctggaagacaggaagtcgtctgttctgaaagcc
atagatgcctctaagaaactaagactagacaagtttcacactcagatggaagagtaccaa
ggccttctagagaataacgggctcgtggggtatgctcaggaagtgctgaaggagacggat
cagtcttgctttgtgcagacggcgaagcagctccatctcagaatacagaaagctacggag
tccctgaagagctttagacctgcagcccaggcttcttttgaagactatgttgttaacata
tcgaaacaaacagaggtgcttggagagttgtcctttttctccagtggcatagacattcct
gagatcaacgaggaacagagtaaagtgtataataacgccttgatagactggcatcatcca
gaaaaggacaaagccgacagctatgttctagaataccgcaagattaatagagacgaagaa
atgatatcatggaatgagatagaagttcacggcacaagtaaagttgtctccaaccttgaa
agcaacagtccctatgcgttccgagtgagagcttacaggggttctatctgcagtccctgc
agcagagaattgatcctgcatactcctccagctccagttttcagtttcctgttcgatgag
aagtgtggctacaacactgagcacctcttgctgaacctgaagagagaccgggtggagagc
agagctggatttaacgtcctcctggctgcggagcgcatccaagtgggccattacacaagc
ttagactacatcatcggggatgtcggagtcacgaaaggtaaacacttctgggcctgccgc
gtggaaccgtattcatacctggtgaaagtgggagttgcttccagcgacaaactgcaagag
tggctgcgctctccccgagatgcagctagtccaagatatgagcaagacagtggacatgac
agtggaagcgaggacgcctgttttgattcttcacagccctttacattagttactataggc
atgaagaaattttttatacccaagtcacctacttcctctaatgaaccagaaaacagagtt
ctccccatgccaacgagtatagggattttccttgactgtgataaaggcaaagtgagcttc
tatgatatggaccacatgaaatgcctgtatgagcgccaggtggactgttcgcatacaatg
tatccggcctttgccttgatgggcagcggaggaattcagcttgaggaagccatcacagca
aagtatctggaatatgaagaggatgtgtag

DBGET integrated database retrieval system