KEGG   Mus musculus (mouse): 320080
Entry
320080            CDS       T01002                                 

Gene name
Zbtb39, 7030401O21Rik, mKIAA0352
Definition
(RefSeq) zinc finger and BTB domain containing 39
  KO
K10511  zinc finger and BTB domain-containing protein 39
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    320080 (Zbtb39)
   04121 Ubiquitin system [BR:mmu04121]
    320080 (Zbtb39)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    320080 (Zbtb39)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     320080 (Zbtb39)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4
Other DBs
NCBI-GeneID: 320080
NCBI-ProteinID: NP_932152
MGI: 2443316
Ensembl: ENSMUSG00000044617
UniProt: Q6PDK0
Position
10; 10 D3
AA seq 712 aa
MGMRIKLQSSNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFL
NTGLDAARTYVVDFITPANFEKILSFVYTSELFTDLINVGVIYEVAERLGMEDLLRACHS
TFPDLESTAIAKSLTSTSDSQCVTLSCPSVDPTHPLGESRGSGEHFGPDRNYVLPTDAGG
SYKEEERSVSGDTNHGLPLPQLPLPPKSEDHDTPVPFTSVPSVATPPPVLGMVSTGIQTS
TSSCQPYKVQSNGDFSKSTFFASDNAVDITTQTNSCLSNSDHSRDPSFGQMDELQLDDVG
DEDLQFEDPAEDIGTAEEVIELSDDSEDDLAFGDSDNRENKAMPCQVCKKVLEPNIQLIR
QHARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQWQLTLHRR
DGIFDNNVIVHPSEPLSGKLGLFPGAASPELKCAVCGKALAKDFHVVRCHILEHVNLKGQ
ACSICDQRHLNLCSLMWHMLSHLGISVFSCSVCASSFVDWHLLEKHMVVHQGLEDVLFRC
HLCSQSFRSEAAYRYHVSQHKCSSGLDARPALGLPHLALQKRKLPAEEFLSEELALQGQP
GNSKYSCKVCGKRFAHTSEFNYHRRIHTGEKPYQCKVCHKFFRGRSTIKCHLKTHSGALM
YRCTVCGHYSSTLNLMSKHVGVHKGSLPPDFTIEQTFMYIIHSKEAEKNPDS
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgggcatgaggatcaaactgcaaagcagcaaccaccccaacaacctgctgaaggaactc
aacaagtgccggctgtcagagaccatgtgcgatgtcaccatcgtggtggggagccgctct
ttccccgcccacaaagccgtgctggcgtgcgcagctggctacttccagaacctcttctta
aacactgggctagatgctgcgcggacctacgtggtggacttcattacccctgccaacttt
gagaagatcctgagttttgtatatacatcagagctcttcacagacctgatcaacgttggg
gtcatctatgaggtcgctgaacgcctgggtatggaggatctgctgcgagcctgccattcc
actttcccagacctagagagcactgcaatagccaagtccttgaccagcaccagcgacagc
cagtgtgtcactctcagttgtccctcagtagatcccacccacccccttggagagtcccgg
gggagtggggaacacttcggtcctgatagaaactatgtgctgcctactgatgcaggagga
agctacaaagaggaagagcggagtgtctcgggtgacactaatcatggcttgcccctgcca
cagctgccactgccaccaaagtcggaagaccacgacacccctgttcccttcacgtctgtt
cctagtgtggcaaccccaccaccagtcctaggcatggtcagcacaggcatccagaccagc
acgagttcttgccagccatacaaagttcaaagcaacggagacttcagtaaaagcaccttc
tttgcctctgataacgcggtagacattacaacccagaccaactcctgtttgagcaatagc
gaccactccagagatccaagctttgggcagatggatgagctccagctggacgacgtgggg
gacgaggacctgcagtttgaggacccggccgaagacatcgggaccgcagaggaggtgatt
gagttgagcgacgacagcgaggacgacctggctttcggtgacagtgacaaccgggagaat
aaggccatgccctgccaggtgtgcaagaaagttctagagcccaacattcagctgatacgg
cagcatgcgcgggaccacgtagacttgctcacaggcaactgcaaggtctgtgagacccac
ttccaggaccgaaactcccgggtgacccatgtcctgtctcacatcggcatcttcctgttt
tcctgcgatatgtgtgagacaaagttcttcacccagtggcagctgaccctgcaccggcgg
gatgggatatttgataacaacgtcattgtccaccccagtgaacccctgtctgggaaactg
ggtctctttccaggggcagcctccccggagttgaaatgtgctgtctgtgggaaagcattg
gccaaagatttccacgtggtccgttgccacatcctcgagcacgtgaacttgaagggccag
gcctgcagcatctgcgatcagcgccacctcaacctctgcagcctcatgtggcacatgctc
tcccatctgggcatctcagtcttctcctgttcggtctgtgccagcagctttgtggactgg
caccttctagagaaacacatggttgttcaccagggcctggaggatgtcctcttccgttgc
cacttgtgcagccagagcttccggtcagaggcagcctaccgctaccacgtcagccagcac
aagtgcagcagcggcctggacgcgcggcctgctctgggactaccacacctagccctccag
aagcggaagctgcccgccgaggagtttctgagcgaagagctggctctgcagggccagcct
gggaatagtaagtacagttgtaaggtctgtggcaaaaggtttgcccacacaagcgagttc
aactaccaccggcggatccacacaggcgagaaaccttatcagtgcaaggtttgtcacaaa
ttcttccgaggtcgctcgaccatcaagtgccacctcaagacgcattcaggggcgctcatg
taccgctgcacagtctgcggccactacagttccacccttaacctcatgagtaaacacgtc
ggggtgcacaaaggcagccttccccctgacttcaccatcgagcagaccttcatgtacatt
atacattccaaagaggctgagaagaacccggacagctga

DBGET integrated database retrieval system