KEGG   Mus musculus (house mouse): 320633
Entry
320633            CDS       T01002                                 
Symbol
Zbtb26, A630026F21Rik
Name
(RefSeq) zinc finger and BTB domain containing 26
  KO
K10505  zinc finger and BTB domain-containing protein 26
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    320633 (Zbtb26)
   04121 Ubiquitin system [BR:mmu04121]
    320633 (Zbtb26)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    320633 (Zbtb26)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     320633 (Zbtb26)
SSDB
Motif
Pfam: zf-C2H2 BTB zf-H2C2_2 zf-C2H2_4 zf-C2H2_11 zf-C2H2_2 zf-met DUF899 zf-CHCC zf-H2C2_5 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 320633
NCBI-ProteinID: NP_950190
MGI: 2444402
Ensembl: ENSMUSG00000050714
UniProt: Q6P9Q3
Position
2:complement(37322180..37333184)
AA seq 440 aa
MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDVEVQGHKIVFAAGSPFLRD
QFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFLQMSHIVERCT
QALWKFIKPKQPMDSKEGSEPQSASPQSKEQQGDARGSPKQDLPCIHPSEDSMDMEDSDI
QIVKVESIGDVSEDRSKKDENQYISSEPTALHSSEPQHSLINSTVENRVNELDQSHLHNY
ALSYTGNDDIIMTSKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMC
LLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCNYCD
MVFAHKPVLRKHLKQLHGKNSFDNANERSVQDLTVDFDSFACTTVTDSNCQPQPDATQVL
DAGKLTQAVLSLRSDSTCVN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtctgaaagatcagatctccttcacttcaagtttgaaaattatggagattcaatgtta
caaaaaatgaacaaattaagagaagagaataaattttgtgatgttacagttctcatagat
gatgttgaggtgcaggggcataaaattgtttttgctgcaggttcccccttcttaagagac
cagtttttactgaatgattcccgagaggtgaaaatctccatattacagagttctgaagtg
gggagacaattgctcttgtcctgttatagtggtgtgctggaattccctgagatggaactg
gtaaattacttgactgctgcgagttttcttcagatgagccacattgtagaacggtgcaca
caggcgctgtggaagtttataaagccaaaacaaccaatggatagtaaagagggatctgaa
ccacagagcgcttctccccagtcgaaagaacagcagggagatgccagaggctctccaaag
caggacttaccttgtattcatccatctgaagacagtatggatatggaggacagtgatatt
cagattgttaaggtagaatctattggggatgtatcagaggatagaagtaaaaaagatgag
aaccagtacatttcttctgaacccactgctttgcactcatcagagccccagcactccctg
ataaactcaactgtggaaaacagagttaatgaactagaccagagccatctccacaattac
gccctctcttacacaggcaatgatgacatcatcatgacctctaaagatgtctttgggcct
aatattcgaggtgtagacaaaggcttacagtggcatcaccagtgcccaaagtgtaccagg
gtattccgtcacctggagaactacgccaaccatttaaaaatgcacaaactgtttatgtgt
ctactctgcggcaagactttcactcagaaaggcaatcttcatcgacacatgcgtgtacat
gccggaattaaacctttccagtgtaaaatctgtgggaaaaccttttctcagaagtgttcc
ttacaggaccatcttaaccttcacagtggagataagccccataaatgtaactattgtgac
atggtttttgcacataagccagttttgaggaaacaccttaaacagctgcatggcaaaaac
agctttgataatgccaatgagaggagtgtacaagacctcacagtggattttgactctttt
gcatgtacaacagtcacagactctaattgccagccacaacctgatgcaacacaggtcctg
gatgcaggtaaactgacccaagctgtcctcagcttaaggagtgacagtacatgtgtgaat
tga

DBGET integrated database retrieval system