KEGG   Mus musculus (house mouse): 328967
Entry
328967            CDS       T01002                                 
Symbol
Arhgef37, 4933429F08Rik
Name
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 37
  KO
K20710  Rho guanine nucleotide exchange factor 37
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    328967 (Arhgef37)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    328967 (Arhgef37)
SSDB
Motif
Pfam: RhoGEF SH3_2 SH3_9 BAR SH3_1 SH3_3
Other DBs
NCBI-GeneID: 328967
NCBI-ProteinID: NP_808496
MGI: 3045339
Ensembl: ENSMUSG00000045094
UniProt: A1IGU4 E9Q5R6
Position
18:complement(61624728..61669994)
AA seq 676 aa
MADFGADEASSKSESPEQEDQGSEDRSLLHQRLAIRELIDTEVSYLHMLRLCASDIRSHL
QQLPPGDLDILFSNIDDIIQVSSRFLRGLQETACREEEQAHLIGNLFLEFQEEFEQVYKV
YCANYDQALLLVKAYQKEPELQKEIQGIIEAAMPQAGPSGLSFFLVIPLQRITKYPLLLQ
KILENTPADASAHPALQRATSALQDVNGNINEYKMRKEVALKYTKVEQLSLRERLARINT
HTLSKKTTRLSQMLKQEAGLVSRTEDKEFDDLEERFQWVSLCVKELRNNVVDFMGNLEVF
LSFRPHERSLDIPGGPAEQYCSLARDLQLHAFLQFKQRLRSLVWQPLCSLARALAGPQNL
IKKRLDKLLDFDRVEEKLLDVGSVTWEEEAARHEYQALNSLLVAELPQFNQLVMQWLGQI
LCTFVVLQRDLADQVLRRAESTMALLPHHHVSEPDFQKLLEHTLGQSSSQLRLFQESFEK
VLPPSTTQPLLPGSEHQMQALLTRYGPEKLYQVSSNINGTGTLDLTLLRGQIVALLQNKD
TKGNNSRWLVDTGGHRGYVPAGKLQLYHPIIPSEKELRGQTGTHEDSWLPAPEPTQLSVP
TVPTMSQVVAVYPFVARSTHELSLQAGQPVTILEAQDKKGNPEWSLVEANGQRGYVPSNF
LARTPSPTPWGWNLPS
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggctgactttggagcagatgaggcctcttccaagtcagagagtcctgagcaggaagat
cagggctctgaggacagatcgctgctccatcagaggctggccatcagagagctcattgac
acagaagtctcctacttacacatgctccgactctgtgcctctgacatcagaagccaccta
caacagctgccaccaggcgatctggacatcctgttctccaacatcgatgacatcatccaa
gtgagcagcaggttccttcgagggctgcaggagacagcctgcagggaagaggagcaagcg
cacctgattggtaacttattcttggaattccaagaggagtttgaacaagtctataaagtc
tactgtgccaactatgaccaggccctgctgctggtcaaggcgtaccagaaggagccagaa
ctgcagaaggagatccagggcatcatcgaagctgccatgccacaagctggaccttcgggt
ctcagtttcttccttgtgatccctctacagaggattaccaagtaccccctcctgctgcag
aaaattctggagaacacacctgcagatgccagcgcccaccctgcccttcagagagccacc
tctgccctccaggatgtgaacggcaatatcaacgaatacaagatgcgcaaggaagtggcc
ttaaagtataccaaagtggagcagctgagccttcgggagcggctggcccgcatcaacaca
catactctttccaagaagaccaccagactgagccagatgctgaagcaggaggcggggctt
gtatcccggacagaagacaaggaatttgatgacctggaggagagattccagtgggtgtct
ctgtgtgtgaaggagctcagaaacaatgtggtcgatttcatgggtaatctggaggttttc
ctcagcttccggccacacgaacggagcctggatatccctgggggacctgcggagcagtac
tgcagcctagcgagggaccttcagctccatgcctttctgcagtttaagcagcggttaaga
agcctggtgtggcaaccattgtgcagtctggccagagccctggctggtcctcagaacttg
atcaagaagcgcctggacaaactcctggacttcgatcgagtagaggagaagctgttagat
gtgggcagcgtgacctgggaggaggaggcagcccggcacgaataccaggcgctcaactcc
ttactagtggccgagctcccacagtttaaccaactcgtcatgcagtggctgggtcagatc
ctgtgcacatttgtggtcctccagagagacctcgccgatcaagtgctacgaagggcagag
agcaccatggctctgctgcctcatcaccacgtctcagagccggacttccagaagctgctg
gagcacacactaggccagagcagcagtcagctccgcctctttcaggagagctttgagaag
gtgcttccaccctccaccactcagccactccttccagggtctgaacaccagatgcaggct
ctccttaccagatatggccctgagaagctataccaggtgtcaagcaacatcaacgggact
gggactctggacctgaccctgctgcggggccaaatcgtggcccttctacaaaacaaggat
accaaaggcaacaacagtcgctggctggtagacacagggggacaccggggctatgtgcca
gctggaaaacttcagttataccaccccatcattcccagtgagaaggagctcagaggccag
acagggacacatgaagactcctggcttccagccccagagcccacccagctctctgttccc
actgtcccaaccatgagtcaggtggtggcagtatacccttttgtggccagaagcacccac
gaactgagtctacaggcaggccagcctgtgaccatcctagaggcccaagacaagaagggg
aacccagaatggagcctggtggaagcaaacggacagaggggctatgtgccttccaacttt
ctagccaggaccccaagcccaactccctggggctggaatcttccctcttaa

DBGET integrated database retrieval system