KEGG   Mus musculus (mouse): 330355
Entry
330355            CDS       T01002                                 

Symbol
Dnah6, 9830168K20, A730004I20Rik, Dnah, Dnahc6, mKIAA1697, mdhc6
Name
(RefSeq) dynein, axonemal, heavy chain 6
  KO
K10408  dynein heavy chain, axonemal
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    330355 (Dnah6)
   05016 Huntington disease
    330355 (Dnah6)
   05022 Pathways of neurodegeneration - multiple diseases
    330355 (Dnah6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    330355 (Dnah6)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     330355 (Dnah6)
SSDB
Motif
Pfam: AAA_6 DHC_N2 AAA_8 Dynein_C AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_5 AAA_lid_1 AAA AAA_18 AAA_22 TsaE Sigma54_activat AAA_16 AAA_33 T2SSE Utp12 DUF853 Caudo_TAP
Other DBs
NCBI-GeneID: 330355
NCBI-ProteinID: NP_001158141
MGI: 107744
Ensembl: ENSMUSG00000052861
Vega: OTTMUSG00000022156
UniProt: E9Q0B6
Position
6 C1; 6 32.37 cM
AA seq 4144 aa
MAFQGTEDEIDLKSIEHQAEENPILARLNKIKAKGILNYVSLKENEPEPPTLVFRHTTKA
QERTRKRQQPVKLEPLPVLKVYQDHKQPEYIYEQNRQKLMSSGILKPSPSTADRASIISL
EAQEAVKRKQVHRPSADVFSPSPTKLPRTSIGRRGLFGMRSSTYPTYTFHDREEVIKANI
RDPLQIIKIVHENEHLGFLYMISAVPKSSIEYDTYNLKVVSYENINKNDYYTISKDAVTH
VYNDDIEYIEIERWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRK
NLFIVNPYLRPALLKINEMCYLLSFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVF
RCAAKDVVRKSCRFALRAAGFIPDDCEVETYEDYFKANIASLVDGPFDLPTYGESEKMTY
TEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTASSLLNFFSDKLKRTPSADVIQKWI
TEEKPEVTEKKGAPLMEKQEEDESLVPMFLTELILTVQSLLFEPSLEDFLDGISGAINHF
ENTVLSVPNLVPDSYFDAFTSPFINKKVEEKTCGPGPNLSAVFEDDRNFLTIIMQIKETI
HAAFDSARLYAATFEKFQLFFKENESLDLEALKQEEPDVQFFSSQLEKYHKQHKDSVALR
PTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMP
TTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSIT
AVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTM
LSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQ
EWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLR
NPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEII
LKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRV
DDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRK
VNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEIL
AQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEPEKVFTNDILAMLSPEGER
VGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTI
SQIMWCRDLTESLECEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITID
VHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRL
VITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYK
MMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLV
MTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKM
TQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFL
TDDALLFSGIISDLFPGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLV
RHGVMLVGPTGGGKTTVYQVLAETLGNLEKLNTDNPFYQPVKTYVLNPKSITMGELYGEV
NNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSE
RIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRTMSKKLNDEVQ
EYLLNLFNRYVDDGLHFVNKKCTQAIPQVDISKVTTLCCLLESLLLSKDGNILSMEQMKL
NTVLCQTFVFCYLWSLGGNLTENYWDSFDTFIRTQFDDNPDARLPSSGDLWSIHIDFDTK
RLDPWERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVI
AKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDD
LNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPR
FIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFPEAVKQTSSNIVEAAVEIYNRMSVDLL
PTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHY
FHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDY
LDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICG
YKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSG
EVPNLFEKDELEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAF
RSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSSVDTGNDDLREKLSLMCVNVHLSV
SHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVL
VDKMKLDLSALEPVLLQKSQDVEALMEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAI
ADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDW
PTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWV
RAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVN
EKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAY
YGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTEN
GILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLE
ELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIK
VTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFT
SEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVI
ASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQ
HKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEAPWLPIQMWFSCCDLE
ESFPIFEGLTKHILLRPISIKLGSFETYINPPVWEGYPKQRHEEEKDHVWGLDFSSFHKL
ILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMG
AFQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNWVFLQNCHLAVSWMLAMEEL
IKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPS
FFEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHE
GKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDDDYTYSDSGIYFAPLA
DSLQDFKEYIEDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSN
DEIVQELVASIQTRVPESLQMEGASESLFVKDPQGRLNSLTTVLGQEVDRFNNLLKLIHI
SLETLNKAIAGLVVMSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGSWVKDLILRTEFV
DLWLKRGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIPVYRDQAAVIE
SAKDIQFGTELPMDKELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPMLPVVHF
EPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLC
QLSE
NT seq 12435 nt   +upstreamnt  +downstreamnt
atggctttccaaggcacagaggatgaaattgacctgaaaagtattgaacaccaggcagaa
gaaaatcctatacttgccagactaaacaaaataaaagcaaagggaattctgaattatgtg
tcactcaaagaaaatgaacctgaacctccaaccctggtatttaggcataccacaaaagct
caagagaggaccagaaagagacagcagcctgtgaagctggagcctctgccagtgctaaaa
gtctaccaagatcacaagcagcccgagtacatatatgaacagaatcgacagaagctcatg
agctctggaattcttaagccatcaccaagcacggctgacagagcttcaatcattagtctc
gaggcccaagaagctgtgaaaaggaaacaggtccatcgaccctctgcagatgtgttctct
ccttctccgactaaactgccccgcacaagtattggaagaagagggctctttggaatgagg
tcttcaacttatccgacgtacaccttccatgaccgagaagaagtcattaaagccaacatt
agagaccccttgcaaatcatcaaaatagtacatgagaatgaacatctcggattcctttac
atgatctctgccgtacccaagtcttccatagaatacgatacatataatctaaaggtcgta
agttatgagaacatcaataaaaatgactactacacaattagcaaagacgcggttacccac
gtttacaatgatgacatcgagtacatcgagattgagcgatgggaacaggagtacctgtac
cacagagagctcacgaagatccccatcttcgctctcttccggaagtggaaggctttcagc
gtgtggaggaagaacgtgcgctccaagaaaatcactggctgtcgaaaagcgcttcgaaaa
aacctgttcattgttaatccttatctacgacccgctcttcttaaaatcaatgagatgtgc
tacctgctgagttttatgggactctgttacattgaaaaattccacacctacaccctgcag
gagttcaaggctgcacaaatagtgcgactgcaggaggtgacagagcgcctggaagttttc
cgatgcgcggcaaaagacgtggtccggaagtcgtgccgctttgccttacgcgctgcggga
tttattcccgatgactgtgaagttgaaacctacgaggattactttaaggccaacattgca
agtcttgtcgatggtccgtttgatttacccacttatggagaatctgaaaaaatgacctac
acagaacaggccagcaaaaggcatcattgcatgaggctcacatgcttcatccgtctgaat
gactacctaattcagaacaccctgcacgtcctaacagtaaacactgccagctctcttctg
aatttcttctcagataaactaaagcgaactccctcagcagacgtcatccagaagtggatt
actgaagagaagccggaagtcactgagaaaaagggggccccactgatggaaaagcaagaa
gaagatgagtctctcgtccccatgttcctcacagaactgattctgacagtgcaatcacta
ctcttcgagccttctttggaagactttctggatggcatttctggggcaattaatcacttt
gaaaacacggtgttgtcagttcctaatctggtgcctgactcgtactttgacgctttcacc
agcccgttcattaacaagaaggttgaggaaaagacctgcgggcccgggcccaacctgtca
gccgtgtttgaggatgacaggaactttctcaccatcatcatgcaaataaaggaaacaatt
cacgcagcgttcgactctgcacgcttgtacgcagcgacatttgaaaagtttcagttattc
ttcaaggaaaacgagagtctggatctagaagccctgaagcaggaggagcctgatgtccaa
ttcttcagttcccagctggaaaaataccataaacagcacaaggactcggtagccctgaga
cccacccgaaacgtaggcctgctgcttatcgacaccaagcagctgaaggagaagctgatc
ccatcaccgctgcggtgcttggaagtgctaaattccatgcttccctgtttgagcaagaaa
aaggtggatgctatcatctcagaggcacaagatgcagaatataaactcgagtttatgcca
actactaccatagaatatgtcaacagcttagttttccttgatgaaattcaggagcggatc
gaaaccctggaggaggaagcgaatgtagtggttcagatgtacaagctcattgaacagtat
caggtgcccacacctcccgaagacttcgccgtttttgccactatgaagccgtctataact
gccgtccggaatgccattgacaaatctgtgggtgatcgagaaacaagcatcaaacagttt
tgtctgcacttgggtcgggaccttgaagatctcaacaatgaggtgaatgaagtcaagctg
ctggcacaggaccctcagatcttggatatcagtgctgaccaggagaaaataaagacgatg
ctgagtgacctgcagtccgttctggatgaccttcagaaacgcgcctttcagtacaaatcc
taccagaagaatttcaaggtggaagtgtccaagtttgatgcattggaagaagttagtgct
gaactcaggctcaaacaactgctctgggattccttgtcggaatgggataatctccagcag
gaatggctgaagtccaaatttgactgcctggatccagaagtcctaaacagtcaagttact
aaatacgctaaatttgtgacccagctggaaaagggcttgccacctaacagtgtggtgccc
cagctcaaacagaaggtggagaaaatgaaagaaaagcttcctgtgatcattgacttgagg
aacccaaccctgaaagcccggcactgggcagccattgagcaaaccgtcgacgccctccta
gtggacactgaaatcccgctgaccttggagaggctgtccgaactgcacgtctttaatttt
gctcaagaaatccaagacatatctgggcaggcttctggggaagctgccttagagataatt
cttaagaaggtggaagactcttggaaaaccacggaatttgtcatccttcctcaccgtgac
tctaaggacgtatttatcctgggtggcacagatgacatacaggtcctacttgatgatagc
accatcaacattgcaaccattgcctcatcccggtatgtgggtcccctgaagtctcgagtg
gatgactggcagaaacagctttccttatttaatcaaacactggaagagtggctgaactgt
cagagaaactggctctacctagaaagcatctttaatgccccagacattcagaggcagctg
cctgcagaagccaagatgttccttcaggtggataagtcatggaaggaaatcatgaggaag
gtcaaccggctgcctaacgcgctccgggctgcgactcagccaggacttctggagactttt
caaaacaataacgcattacttgaccaaattcagaaatgtctggaggcatatttagagtca
aagagagttatcttcccaaggttttacttcttgtcaaatgatgagctcctggagattttg
gcccagacacgcaatccgcaagccgtgcagcctcacctaaggaaatgcttcgactccatt
tcaaagctcgagtttgccctcatgcctcctacagaagggaaaatacccggcatggatact
gagccagaaaaggtcttcaccaacgacatcttggcaatgctgtcacctgagggggaacgg
gttggcctggggaaaggcctcaaggcaagaggcaatgtggaagaatggcttggtaaggtg
gaggaagccatgtttacgtctctccgccgcctgtgcaaagctgccatcgctgattaccag
gggaaacccaggacagagtgggtgatcgctggccacccttctcaagtgatcctgaccatt
tctcagatcatgtggtgccgggatttaactgagagtctagaatgtgaaggtgacaacgta
gacgccctggaagattttgaacaagtaaattttgagagattaaatgccctggccgcaata
gttcgaggcaatcttcctaaattacacagaaacatcatcactgcattgattaccattgat
gtgcacgcaagagatatagtttctgagctggttcaagccaaggtcgactcagccgactcc
ttcgactggcagcggcaactgcgctattactgggacatggacctggataactgcgtggct
agaatggcgttgtcccagtacacctatgcctatgagtacttgggagcgtgcccgaggctg
gtcatcactcctctcacagatcgctgctacctttgcctcatgggggctttgcagcttgac
ctcggaggcgcaccagctggcccggctggcacagggaaaacagagaccaccaaagaccta
gcaaaagccctcgccatccagtgtgtggtcttcaactgctctgacggtttggactacaag
atgatggggcgcttcttcagtggcttggcacagtcaggggcctggtgctgctttgacgaa
ttcaaccggattgacatagaagtcctgtcggtcattgcccagcaactcatcaccattagg
aatgccaaagccgcaaagctctccagattcatgtttgagggacgggaaatcaagctcgtt
atgacctgcgcggctttcatcaccatgaatcctggctacgcaggcagaacggaactgccg
gacaacctgaaggccctgttcagaccgatggctatgatggttcccaattatgcgctgatt
gcagaggtgattctgtattctgaaggatttgagtcgagtaaaatactcgcaaggaagatg
acacagatgtacaagctctgcagcgagcagctatcgcagcaggaccactatgactttggc
atgagggccgtcaagtctgtactggtcatggctgggtctctaaaaagagagaacccagac
ctcagtgaagatgtggtcctgatcagagcgttgcgagactccaacttgccgaaattctta
acagacgatgctctcctgttcagtgggatcatatctgatctttttcctggagtccaaatc
ccagaacatgactatggtattttgcagtcgacaattgtggaggtcatgattaaccagaac
cttcagcctgagttatgtatggtcaaaaaggtgatacagctgtatgaaacgatgctggtg
agacacggcgttatgttagtagggccaacgggaggtggcaagaccacagtttaccaagta
ttagcggaaaccttagggaacctcgaaaagctcaacacagacaatcctttttatcagccg
gtaaaaacctatgttcttaaccccaaatcgatcacaatgggagagttatatggggaagtc
aataacgtgaccttggaatggaaggacggtttgatggcactaagtgtccgagcagctgtg
aacgatacttcagaagaccataaatggataatcagcgatgggccagtggacgcgctttgg
attgaaaatatgaatacggtgttggacgacaacaagatgctgtgcctggctaacagcgaa
aggattaaactcacacctcagatccacatgctttttgaggtacaagacctcagggtggcc
tctcctgccacggtcagccgatgtggaatggtgttcgtggaccccgaagaactcaagtgg
atgccttatgttaaaacgtggatgaggaccatgtctaaaaaactgaatgacgaagtccaa
gaatatttattgaatcttttcaatcgttatgttgatgatgggttgcattttgtgaacaaa
aagtgcacccaagctatcccacaggtggacatcagcaaagtgaccacactgtgctgcctg
ctggagtctctgctgctcagcaaagatggaaatatcttgtcaatggaacaaatgaagctg
aacactgtactgtgccagacttttgtgttctgttacttgtggtctctgggtggaaactta
actgaaaattactgggattcttttgatacatttattagaacacaatttgatgataatcct
gatgccaggcttcccagctctggagatctgtggagcattcatatagactttgacaccaaa
cgcctggacccctgggagcgcattatacccaccttcaagtacagcagggatgtcccattc
tttgagatgcttgtccccacaacagacacagtgcgctatggctatctaatggaaaagctg
ctggccgtcaggcattcggtgttgtttacgggaacaactggcgttggcaagtccgttatt
gcaaaaggattgctgaatagaattcaagaatcagctggctatgtccctgtttatctaaat
ttttctgcccaaacttcatcttcaaggacacaggagatcattgagtcaaaactggaacga
aagagaaaaaatattctaggagcaccaggaaataaacaagtggtgatttttgttgatgat
ctgaatatgccccggctggaccgctatggctcccaaccaccaattgaactgcttcggcag
tatcaagattttggtggattctatgatagaaacaaactcttttggaaagaaatacaggat
gtaacaattgtgtcagcatgtgcacctccaggagggggacgcaatcctgtgacaccccgc
ttcatccgacacttcagcatgctgtgtctcccgatgccctcggagcacagtctgaagcag
atattccaggccatcttgaatggcttcctggctgacttcccagaagcagtaaagcaaacg
tcatcaaatattgtagaagctgcagttgagatttataacaggatgagtgtcgatctcctg
ccaaccccagccaagtcccattatgtctttaacctgagagacttatccaagtgtgtgcaa
ggtattctccaatgtgatccaggaacaataagagaagaacttcagatatttagactgttt
tgccacgaatgtcaaagagtgttccatgaccgcctgatcaataatgaagacaaacactac
ttccatctcattttgacagaaatggccaacaagcactttggaattgcaattgacctggaa
tactttttaagcaagcccatcatatttggggatttcattaagtttggagcagagaagtct
gaccgcatctacgatgatttacccgacatggagaaaatcgagaatgttctgcaggactat
ctcgatgactataacctcacaaaccctaaggaagtcaagctggtgttcttccaggatgcc
atagagcacgtgtccagaattgcacggatgatccgccaggaaaggggcaacgcgctgctg
gttggtgtaggaggcacgggaaagcagtccctcacgagacttgcagctcatatatgtggt
tacaagtgtatgcagatcgaacttagccgagggtataattatgacaatttccacgaagac
ctgaggaaattgtacaagatggctggtgtggaagacaaagatatggttttccttttcaca
gacacccagatcgtcgtcgaagagttccttgaagacataaacaacattctgaattctggt
gaagtgcctaatttatttgagaaggacgagttggagcacgttttagcagccacccgacca
aaagcaaaggaagttggaatctctgaggggaacagagatgaggtgtttcaatatttcatc
agcagagtacgacagaagctgcacatagttctctgcatgagcccggttggcgaggccttc
aggtcccgatgccggatgtttccctccctggtaaactgctgcaccattgactggtttgtc
cagtggcccagggaagcgctcctgtctgtatcaaagtcattcttctcatctgtcgacact
ggaaacgatgatctaagagaaaagctttccctcatgtgtgtgaacgtgcacctgagcgtc
tcccacatggcggagcgttactacaacgaactgcgcaggcgctactacaccacgcccacc
tcctacctggagctcatcaatctctacctgaccatgctcactgagaaaaggaagcagtta
gtttcagcacgagatcgtgtaaagaatggtctcaccaagctactagaaacaaatgtacta
gtagataaaatgaaattagacctttcggctttagaacctgtgctactacagaaatcacaa
gatgttgaagccctgatggaaaaactagtggtggaccaagaaagtgctgatcaggtccgt
aatgttgtgcaagaagatgaagcaatagcaaaggtgaaagctgaagagactcaagcgatc
gctgatgatgcccagagagacctggaggaggcactccccgccctcgaagctgccaataaa
gcactggattccttagacaaagcagatatctctgaaatcagagtcttcacaaagcccccc
gacttggtcatgactgtgatggaagccatctccatcctcttaaatgccaagcccgactgg
ccaacagcaaagcaacttcttggtgactctaacttcctaagaaggcttttagaatacgat
aaggagaacataaagccgcagatcctgttgaagcttcagaagtacatcaacaatcctgac
ttcgtgcctgagaaggtggagaaggtgtccaaggcctgcaaatccatgtgcatgtgggtg
agagccatggatctgtactctcgggtggtcaaggaagttgaaccaaagagacagaagctc
cgtgctgcccaggctgaacttgacgctacaatggctaccctgaaagaaaagcaagcattg
ctgaagcaagtggaagatcaaataaagactttgcaagacaagtacgagaaaggagtgaat
gagaaagaaagtctggcaaagaacatggccctgaccaaagcgcgcctgatacgtgctgga
aagctaacggctgcattaggagacgagcaggttcggtgggaagaaagcattgagaaattc
caggaggagctagcaaacatcgttggaaacgtgttcatagcagcagcttgcgtggcttat
tacggggctttcacagcccagtacaggcagctgcttatagagtggtggattgaatcctgc
ctggccctggagatccccattgacccctccttcagtctcattaacattcttggtgacccc
tatgaaatccggcagtggaacacagatggactgcccagagacttgatatcaactgagaat
ggcattttggttactcaggggagaagatggcctttgatgattgatcctcaagatcaggcc
aatcgatggataagaaacaaggaaagcaagagtgggttaaaggtcattaagcttacagac
accaatttcttacgaatactggaaaattccatccgactgggtttacctgtcttactggaa
gagctcagagaagtcttggatccagccctggaacccatccttttaaagcagacgttcatg
agtggcggaagactgctcatccacctcggagattcggacatcgattatgacaagagtttc
aggttttacatgacatccaaaatgccgaatcctcactacctacctgaggtgtgcattaaa
gtcaccatcatcaatttcactgtaactaaatcgggtctggaggatcagttgctaagtgac
gttgtgcgacttgaaaagcctgagttggaggaacagaggatccagctaatcgtgaggatc
aacagcgataaaaaccagctgaaatctatcgaagacaaaatcctgaaactgctctttaca
tctgaagggaatattctggataacgaagaacttattgatacactccaggactcaaagatc
acttcgggtgccattaaaaccaggctgaaggaagcagagtccacagagctgatgatcaac
atagctcgagagaggtaccgcccggtggccactcagggctccgtgatgtacttcgtcata
gccagcctctcggaaatcgaccccatgtatcagtattcactgaaatattttaaacagttg
ttcaacacaacaatcgaaacatctgagaagagtgacaacctgcatgaacgcctgaaaatc
ctcctgcagcagaccctcctcactgcctacaccaatgtgtctcggggactcttcgagcag
cacaaactcatctacagcttcatgctctgtgttgacatcatgcgcgagcatgagcagcta
acggaggccgagtggaatttcttcctccgaggttctgcagggatggagaaggagcgccct
cccaagccagaagccccctggctgcccattcagatgtggttctcgtgctgtgatctagaa
gagtcatttcccatttttgaaggacttacaaaacatatactgttgcgtcccatttccata
aaattaggatcttttgagacctatattaacccaccggtctgggaaggataccctaaacag
agacacgaagaggagaaggaccatgtttggggcttagacttcagctctttccataagcta
attcttgttaaatgctgtaaagaagaaaaggtggtttttgctcttacagactttgtgata
gagaatcttggcaaacagtttattgagacgcctccagtggacctggccactctgtaccag
gacatgtcaaacagcacgcccctggtctttatcttgagcacaggctctgatcccatgggc
gcctttcaaaggtttgccagggagagcgggtatgcagaacgagtgcagtcaatttctctg
ggacaagggcagggccccattgctgagaagatgatcaaggatgcaatgaaaaccggaaac
tgggtatttctgcagaactgccatcttgccgtttcttggatgctggcaatggaagagctg
atcaaaaccttcacggatccaaatcagacaatcaaggacactttccggctttttctaagc
tccatgccttgttccacatttcctgtgacagtccttcagaattctgtcaaggtaaccaat
gagcctccaaaaggcttgcgtgcaaatatcaggcgagcctttactgaaatgacaccttcg
ttttttgaagaaaacatacttggaatgaaatggagaaaactaatattcggcatttgtttc
ttccacgcaattattcaggagagaaagaagtttggcccccttggctggaatatctgctat
gaatttaatgacagtgatagagaatgtgccttactgaacctcaacctttactgtcacgaa
ggaaagatcccctgggacgcgctaatttacattactggtgagatcacctacggggggaga
gtgacagacacctgggatcagagatgccttcgaactgtcttgaaaagatttttctctcct
gaaacattggatgatgattacacatactctgactcaggcatctattttgcccccttggct
gacagcctccaagactttaaggagtacattgaagatctacctttgatagatgatccagaa
atctttggaatgcatgaaaatgctaacctcgtttttcagtacaaagagaccaacactctg
atcaccaccatccttgaggtccagccaaggtcctcctctggcggccagggcaaaagcaat
gatgaaattgtccaggagcttgtggcttcaatccagaccagagttccagaatctctgcag
atggagggtgcttccgagagcctttttgtcaaggaccctcaaggacgcctgaactctctg
accaccgtccttggccaggaagtggaccggttcaacaatctcctgaagttaatccacatc
tctctagaaacactcaacaaagccattgctgggcttgtggtgatgtctgaagaaatggaa
aaagtgtatcagagtttcctgaacaaccaggttccctctctttggtctaacacggcctac
ccatccctgaagccactgggatcatgggtcaaagaccttattctgaggactgagttcgtg
gacctgtggctcaaacgaggacagcctaaatccttctggatttcggggttcttcttccca
caaggatttctcacagggaccctccagaaccacgctagaaaatataatttgcctatagac
gagctgagtttcaagtataacatgatcccagtctaccgagaccaagctgcagtgatagaa
tcagccaaggacattcaatttggaacagaactgcccatggacaaggagttgccctctcct
gaagatggggttcttgttcatggaatgttcatggatgcttctcggtgggatgataaagac
atggtcatagaagacgcattgccaggacagatgaaccccatgctgcctgtagttcacttt
gaaccaaaacaaaactatgagccagtccacacactctaccactccccactctacaaaaca
ggagcccgggcaggaacactttcaaccacaggccattcaaccaactttgtggtgactgtc
ctcttaccctccaagaggatcagtgattactggatctccaaggggtcagcgttgctctgc
cagctgagtgagtaa

DBGET integrated database retrieval system