KEGG   Mus musculus (mouse): 338352
Entry
338352            CDS       T01002                                 

Symbol
Nell1, B230343H07Rik, l7R6
Name
(RefSeq) NEL-like 1
  KO
K24342  protein kinase C-binding protein NELL
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    338352 (Nell1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   338352 (Nell1)
SSDB
Motif
Pfam: EGF_CA VWC EGF_3 cEGF TILa Laminin_G_2 Laminin_G_3 EGF Plasmod_Pvs28 Laminin_G_1 EGF_2 hEGF
Other DBs
NCBI-GeneID: 338352
NCBI-ProteinID: NP_001032995
MGI: 2443902
Ensembl: ENSMUSG00000055409
Vega: OTTMUSG00000024734
UniProt: Q2VWQ2
Position
7; 7 B4
AA seq 810 aa
MPMDVILVLWFCVCTARTVLGFGMDPDLQMDIITELDLVNTTLGVTQVAGLHNASKAFLF
QDVQREIHSAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSG
PREEIRYHYIHGGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPET
NLPPGSNLWLGQRNQKHGFFKGIIQDGKIIFMPNGFITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLGQLENCHCEKTCQVSGLLYRDQDSWVDGDNCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHISGQCCKVCRPKCIYGGKVLAEGQRILTKTCRECRGGV
LVKITEACPPLNCSEKDHILPENQCCRVCRGHNFCAEAPKCGENSECKNWNTKATCECKN
GYISVQGNSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCIPGYIRVDDFSCTEHDDC
GSGQHNCDKNAICTNTVQGHSCTCQPGYVGNGTVCKAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECAEGFVECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWILREDRCSVCSCK
DGKIFCRRTACDCQNPNVDLFCCPECDTRVTSQCLDQSGQKLYRSGDNWTHSCQQCRCLE
GEADCWPLACPSLSCEYTAIFEGECCPRCVSDPCLADNIAYDIRKTCLDSSGISRLSGAV
WTMAGSPCTTCQCKNGRVCCSVDLVCLENN
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgccgatggatgtgattttagttttgtggttctgtgtgtgcaccgccaggacagtgctg
ggctttgggatggaccctgaccttcagatggacatcatcactgaacttgaccttgtgaac
accaccctgggcgtcactcaggtggctggactacacaatgccagtaaggcatttctgttt
caagatgtacagagagagatccactcagcccctcatgtgagtgagaagctgatccagcta
ttccggaataagagtgagtttacctttttggctacagtgcagcagaagccgtccacctca
ggggtgatactgtcgatccgggagctggaacacagctattttgaactggagagcagtggc
ccaagagaagagatacgctatcattacatccatggcggcaagcccaggactgaggccctt
ccctaccgcatggccgatggacagtggcacaaggtcgcgctgtctgtgagcgcctctcac
ctcctactccatgtcgactgcaataggatttatgagcgtgtgatagatcctccggagacc
aaccttcctccaggaagcaatctatggcttgggcaacgtaatcaaaagcatggctttttc
aaaggaatcatccaagatggcaagatcatcttcatgccgaacggcttcatcacacagtgc
cccaacctaaatcgcacttgcccaacatgcagtgatttcctgagcctggttcaaggaata
atggatttgcaagagcttttggccaagatgactgcaaaactgaattatgcagagacgaga
cttggtcaactggaaaattgccactgtgagaagacctgccaagtgagtgggctgctctac
agggaccaagactcctgggtagatggtgacaactgcaggaactgcacatgcaaaagtggt
gctgtggagtgccgaaggatgtcctgtcccccactcaactgttccccagactcacttcct
gtgcatatttctggccaatgttgtaaagtttgcagaccaaaatgtatctatggaggaaaa
gttcttgctgagggccagcggattttaaccaagacctgccgggaatgtcgaggtggagtc
ttggtaaaaatcacagaagcttgccctcctttgaactgctcagagaaggatcatattctt
ccggagaaccagtgctgcagggtctgccgaggtcataacttctgtgcagaagcacctaag
tgtggagaaaactcggaatgcaaaaattggaatacaaaagcgacttgtgagtgcaagaat
ggatacatctctgtccagggcaactctgcatactgtgaagatatcgatgagtgtgcagca
aagatgcactactgtcatgccaacacggtgtgtgtcaacttgccggggttatatcgctgt
gactgcatcccaggatacatccgtgtggatgacttctcttgtacggagcatgatgattgt
ggcagcggacaacacaactgtgacaaaaatgccatctgtaccaacacagtccagggacac
agctgtacctgccagccaggctacgtgggaaatggtactgtctgcaaagcattctgtgaa
gagggttgcagatacggaggtacctgtgtggcccctaacaaatgtgtctgtccttctgga
ttcacaggaagccactgtgagaaagatattgatgaatgtgcagagggattcgttgagtgc
cacaaccactcccgctgcgttaaccttccagggtggtaccactgtgagtgcagaagcggt
ttccatgacgatgggacctattcactgtccggggagtcctgcattgatattgatgaatgt
gccttaagaactcacacttgttggaatgactctgcctgcatcaacttagcaggaggattt
gactgcctgtgtccctctgggccctcctgctctggtgactgtccccacgaaggggggctg
aagcataatgggcaggtgtggattctgagagaagacaggtgttcagtctgttcctgtaag
gatgggaagatattctgccggcggacagcttgtgattgccagaatccaaatgttgacctt
ttctgctgcccagagtgtgacaccagggtcactagccaatgtttagatcaaagcggacag
aagctctatcgaagtggagacaactggacccacagctgccagcagtgccgatgtctggaa
ggagaggcagactgctggcctctagcttgccctagtttgagctgtgaatacacagccatc
tttgaaggagagtgttgtccccgctgtgtcagtgacccctgcctggctgataatattgcc
tatgacatcagaaaaacttgcctggacagctctggtatttcgaggctgagcggcgcagtg
tggacaatggctggatctccctgtacaacctgtcaatgcaagaatgggagagtctgctgc
tctgtggatctggtgtgtcttgagaataactga

DBGET integrated database retrieval system