KEGG   Mus musculus (mouse): 66105Help
Entry
66105             CDS       T01002                                 

Gene name
Ube2d3, 1100001F19Rik, 9430029A22Rik, AA414951
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 3
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66105 (Ube2d3)
   04120 Ubiquitin mediated proteolysis
    66105 (Ube2d3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66105 (Ube2d3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     66105 (Ube2d3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   66105 (Ube2d3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Motif
Other DBs
NCBI-GeneID: 66105
NCBI-ProteinID: NP_079632
MGI: 1913355
Ensembl: ENSMUSG00000078578
Vega: OTTMUSG00000054825
UniProt: P61079 Q4QQL2
Position
3; 3 G3
AA seq 147 aa AA seqDB search
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaacggattaataaggaacttagtgatttggcccgtgaccctccagcacaa
tgttctgcaggtccagttggagatgacatgtttcattggcaagccacaattatgggacct
aatgacagcccatatcaaggtggtgtattctttttgacaattcattttcctacagactac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtcttgatattctaagatcacagtggtctcctgctttaactatttct
aaagttcttttatccatttgttcactgctatgtgatccaaacccagacgaccccctagtg
ccagagattgcacggatctataaaacagacagagataagtacaacagaatatctcgggaa
tggactcagaagtatgccatgtga

DBGET integrated database retrieval system