KEGG   Mus musculus (mouse): 71768Help
Entry
71768             CDS       T01002                                 

Gene name
Vwce, 1300015B04Rik
Definition
(RefSeq) von Willebrand factor C and EGF domains
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: VWC EGF_CA cEGF FXa_inhibition hEGF RecO_C
Motif
Other DBs
NCBI-GeneID: 71768
NCBI-ProteinID: NP_082189
MGI: 1919018
Ensembl: ENSMUSG00000043789
UniProt: Q3U515
Position
19; 19 A
AA seq 929 aa AA seqDB search
MWARLLLHVAYILIPLLGSSARGYTGRKAPGHYSAERRRLGPHVCLSGFGSGCCPGWAPS
MGSGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGATCPEAHGSCGEYGCDLTCNHGGCQE
VARVCPVGFLMTETAVGIRCADIDECLSSSCEGHCVNTEGGFVCECGPGMQLSADRHSCQ
DTDECLGTPCQQRCKNSIGSYKCSCRAGFHLHGNRHSCIDVNECRRPQERRVCHHTCHNT
VGSFLCTCRPGFRLRSDRVSCEAFPKAVLAPSAILQPRQHPAKMSLLLPEAGRPALSPGH
SPPPGAPGYPTGVRTISQPSTTQVLPTFFPTQLISTPVPSSSPLGTLGPPSLLQGAVGTP
SSPRGPESPKLGAGSSSCWHLGATYESGSRWNQPGCSQCLCQDGEVTCGGVRCDATCSHP
VPPRDGGCCPSCTGCFHSGAIRAEGDVFSPPEENCTVCVCLAGNVSCISPECPPGPCKAS
PQSDCCTCVPGRCYFHGRWYTDGAVFSGGGDDCTTCVCQNGEVECSFTPCPELECPREEW
LLGPGQCCFTCREPTPTTGCSLDDNGVEFPIGQIWSPGDPCELCVCQADGSVSCKRTDCV
DSCPHPIRIPGQCCPDCSAGCTYTGRIFYNNETFPSVLDPCLSCICLLGSVACSPVDCPI
TCTYPFHPDGECCPVCHDCNFEGRKVVNGQVFTLDDEPCTRCICQLGEVSCETVPCRPIC
TDPSCPDSVFPLEEKQQPSPHGELAKAARNARGDTEVPVNCSSCPGPPSASPTRPMVHLL
QRLLRTNLSNIQSASPSPPIAQTSSSPLLEPEGISLGKPRASQPPEPSAGSPVSPRLSTL
PPAIPGTPLSPVTPESSSSTFGTQTAFQWLLSATPLTEAETPSMTNADLSETLTTSSSSQ
RLSAALPDTPNPVPQQSTIDTPKKENSTI
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctagactgttgctccatgtcgcctacatcttgatcccgttgctggggtcttca
gcccgaggctataccgggaggaaggcgccagggcactactctgcggagagacgtcgtctg
gggccccacgtctgcctctctggctttgggagtggctgctgccctggctgggccccttcc
atgggcagcgggcactgtaccctgcccctctgctcctttggctgtgggagtggcatctgc
atcgctcccaatgtctgttcctgccaggatggagagcaaggggccacttgcccagaagcc
catggatcctgcggggagtatggctgtgatctcacctgtaaccatggtggctgtcaggag
gtagcccgagtatgccctgtgggtttcttgatgactgagacagctgttggtatccggtgt
gcggacattgacgagtgtttaagctcatcttgtgagggtcactgcgtgaacacagaaggt
ggcttcgtgtgtgaatgtgggccaggcatgcaactgtctgctgatcgtcacagctgccaa
gacactgacgagtgcctgggaacaccctgccagcagagatgtaagaacagcattggtagc
tataagtgctcctgccgcgctggcttccacctccacggcaaccgacactcctgtatagat
gtcaacgagtgtcggcggccacaagagaggagagtctgtcaccacacctgccacaacact
gtgggcagcttcctgtgcacctgtagacctggtttcaggcttcgatctgaccgtgtgtcc
tgtgaagctttcccgaaggccgttctggccccatctgccatcctgcagccccgacagcat
cctgctaagatgtccctgctcctccctgaggcaggccggcctgccctgtccccaggacac
agccctcctccaggggccccaggataccccactggagttagaacaatcagtcagccatct
accacccaggtcctacccacattctttcccacacagttgatatccactccagtgccaagt
tcctccccactggggacccttggacccccctcactcctccagggggctgtagggacccct
tcctcacctaggggtcctgaaagcccaaagctgggagcagggtcctcttcctgttggcac
ctgggagccacgtatgaatcaggcagccgctggaaccagcccggatgttctcagtgcttg
tgccaggatggagaggtgacctgtggaggagtaaggtgtgacgctacctgttcccaccca
gttcccccgagagatggggggtgctgcccctcttgcactggctgctttcacagtggcgct
atccgagccgaaggggatgtgttttcacctcctgaggagaactgtactgtgtgtgtctgt
ctggctggaaatgtttcttgtatctctcccgagtgtccccctggtccctgcaaggcttcc
ccacagtcagattgctgtacttgtgttccagggagatgctatttccatggccggtggtac
acggatggggctgtgttcagtgggggtggtgacgactgtaccacctgtgtctgccagaat
ggggaggtagagtgctccttcacaccatgtccagagctggagtgccctcgagaggagtgg
ctgctgggcccaggacagtgctgttttacctgtcgggaacccacacccaccacaggctgc
tctctggatgacaacggggttgagtttccgatcggacagatctggtcgcctggtgatccc
tgtgagttatgcgtctgccaggcagacggctctgtgagctgcaagaggacagactgcgtg
gactcttgcccgcaccccatccggattcctggacagtgctgtcctgactgttcagcaggc
tgcacctacacaggtagaatcttctacaacaacgaaacgttcccgtcagtgctcgacccc
tgtctgagctgcatctgcctgctgggctcagtggcctgttcacctgtggactgtcccatc
acctgtacctaccccttccacccggatggcgagtgctgccctgtatgccacgactgtaac
ttcgaagggagaaaggtagtgaatggtcaggtgttcaccttggatgatgagccctgtacc
cggtgcatctgccagctgggagaggtgagctgtgagacggtaccctgccggccaatctgt
actgacccctcctgcccagattctgtgtttcctctagaagaaaagcagcaaccatcccct
catggagaacttgccaaagctgcacggaacgcccgtggagacactgaagtccctgtcaac
tgtagctcctgcccggggcctccatcggcatcacctacaagacccatggtccacctcctg
cagaggcttttaagaacaaacctgtctaacatacagtctgcatccccaagccctcccata
gcccagacctcatcctcacccctgttggagccagagggcatatctcttgggaagcccaga
gcctcccagccccccgagccctcagcagggtcacctgtctctcctagactgtccactcta
cctccagccattccagggactcctttgtcacctgtcactccagaaagctcttcttcaacc
tttgggactcagacagcattccagtggcttctgtctgccacccccttaactgaggcagaa
acaccttcaatgaccaatgctgacctctcagagaccctcaccacttcctcgagctctcaa
aggctatctgcagctctcccggacacccccaaccctgttccccaacagtccacaattgac
accccaaagaaggagaactctactatctga

DBGET integrated database retrieval system