KEGG   Mus musculus (house mouse): 71966
Entry
71966             CDS       T01002                                 
Symbol
Nkiras2, 2410003M04Rik, 4930527H08Rik, D630018G21Rik, KBRAS2
Name
(RefSeq) NFKB inhibitor interacting Ras-like protein 2
  KO
K17197  NF-kappa-B inhibitor-interacting Ras-like protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    71966 (Nkiras2)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Nki-Ras
    71966 (Nkiras2)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU Dynamin_N DUF2121 RsgA_GTPase AAA_16 UPF0113 DUF2677 IU_nuc_hydro
Other DBs
NCBI-GeneID: 71966
NCBI-ProteinID: NP_082300
MGI: 1919216
Ensembl: ENSMUSG00000017837
UniProt: Q9CR56
Position
11:100510007..100518436
AA seq 191 aa
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFY
DTRGLRDGAELPKHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGN
KCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFIYLASKMTQPQSKSAFPLS
RKNKGSGSLDG
NT seq 576 nt   +upstreamnt  +downstreamnt
atggggaagagctgcaaggtggtcgtgtgcggccaggcatctgtgggcaaaacttcaatc
cttgagcagcttctgtacgggaaccatgtcgtgggttctgagatgatcgagacccaggag
gacatctatgtaggctccatcgagacagaccgaggggtgcgggagcaggtgcgtttctat
gatacacggggtctccgggatggggccgagctgcccaagcactgcttctcctgcaccgat
ggctacgtcctggtctacagcacagacagccgagagtcgttccagcgcgtcgagctgctc
aagaaggagatcgacaagtccaaggacaagaaggaggtcaccatcgtggtccttggcaac
aagtgtgacctgcaggagcagcgtcgcgtagaccctgacgtggcccagcactgggccaag
tccgagaaggtgaagctatgggaggtgtcggtggctgaccgacgctccctcctagagcct
ttcatctacctggccagcaagatgacccagccgcagagcaagtctgccttccccctcagc
cgcaagaacaagggcagcggctccttggatggctga

DBGET integrated database retrieval system