KEGG   Mus musculus (house mouse): 72198
Entry
72198             CDS       T01002                                 
Symbol
Mtrex, 2610528A15Rik, Skiv2l2, mKIAA0052
Name
(RefSeq) Mtr4 exosome RNA helicase
  KO
K12598  ATP-dependent RNA helicase DOB1 [EC:3.6.4.13]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    72198 (Mtrex)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    72198 (Mtrex)
   03041 Spliceosome [BR:mmu03041]
    72198 (Mtrex)
   03009 Ribosome biogenesis [BR:mmu03009]
    72198 (Mtrex)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    72198 (Mtrex)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     72198 (Mtrex)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     72198 (Mtrex)
Spliceosome [BR:mmu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    72198 (Mtrex)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    72198 (Mtrex)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    72198 (Mtrex)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    72198 (Mtrex)
SSDB
Motif
Pfam: rRNA_proc-arch DSHCT DEAD Helicase_C AAA_19 AAA_22
Other DBs
NCBI-GeneID: 72198
NCBI-ProteinID: NP_082427
MGI: 1919448
Ensembl: ENSMUSG00000016018
UniProt: Q9CZU3
Position
13:complement(113004306..113063914)
AA seq 1040 aa
MADAFGDELFSVFEDDSTSAAGAKKDKEKEKWKGPPGSADKAGKRLDTKLQSESASGGKN
KRDLDVEGTDEPIFGKKPRIEDSINEDLSLADLMPRVKVQSVETVEGCTHEVALPADEDY
IPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREK
QRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEV
MREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQ
PCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK
GRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEE
VFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFAT
ETFAMGINMPARTVLFTNARKYDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEK
MSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVV
EKVKNSEEQYNKIVIPNEENVVIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKV
KNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESLKNSATEAAKPAKPDE
KGEMQVVPVLVHLLSAISTVRLYIPKDLRPVDNRQSVLKSIQEVQRRFPDGVPLLDPIDD
MGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCERKAQIALDIKSAKRELKKA
RTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSS
EQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEIDEETYLSSF
KPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENK
FAEGITKIKRDIVFAASLYL
NT seq 3123 nt   +upstreamnt  +downstreamnt
atggcggatgctttcggggatgagcttttcagcgttttcgaggatgattcgacctctgca
gcaggagccaagaaagacaaagagaaagagaaatggaaggggccaccagggtctgcagac
aaggccgggaaacgactggataccaaattacaatcagagtcagccagtggggggaaaaac
aaaagagatctagatgttgaaggcactgatgaacctatttttggcaagaagccgagaata
gaagactcaattaatgaagatttaagcctggcggacctgatgcccagagtcaaggtacag
tcagtggaaacagttgaaggctgcacacatgaggtcgctcttcctgcagatgaggattat
ataccacttaaacctcgagttgggaaggcagcaaaggaatacccattcattcttgatgct
ttccaaagagaagccattcagtgtgttgataataaccagtctgtgctagtatctgctcat
acgtcagcagggaagaccgtgtgtgccgagtatgctattgcattggctttaagagaaaaa
cagcgtgtaatatttaccagccctattaaggctctaagtaatcagaaataccgtgaaatg
tatgaagaatttcaagatgtggggctgatgacgggagatgttactattaatcccacagca
tcttgtctcgttatgactacagagattttgagaagtatgctgtatagaggctctgaagtt
atgcgagaagttgcttgggtcatatttgatgaaattcattacatgagagattcagagcgt
ggtgtagtatgggaagaaactattattttgcttccagataatgttcactatgtctttctt
tcggctactattccaaatgctcgacagtttgctgaatggatttgtcacctacataaacag
ccctgtcatgttatttacactgattatcgacccactccactgcaacactacatatttcca
gcagggggagatggccttcacctggtggttgatgaaaatggtgacttcagagaagataat
tttaacactgcaatgcaagtgctgcgggatgcaggtgatttggccaaaggagaccagaag
ggacggaaaggaggaacaaaaggtccatcaaatgtgttcaagattgtgaagatgattatg
gagagaaatttccagcctgtgatcatcttcagtttcagtaagaaggactgtgaagcatat
gctcttcagatgacgaagctagacttcaacacagatgaagaaaagaagatggttgaagaa
gttttcaataatgcaattgactgcttgtctgatgaagataaaaagctccctcaggttgaa
catgtgcttccacttttgaagcgggggattggtattcaccatggtggcttacttcctatt
ttgaaagaaactatagaaattctcttttctgaaggattgataaaggctttatttgccaca
gagacttttgctatgggaattaacatgccagctagaactgttttatttacaaatgcccgt
aaatatgacggaaaggacttcagatggatttcctctggcgagtacatccagatgtctggt
cgcgcaggaaggagaggcatggacgacagagggattgtgattcttatggtagacgagaag
atgagcccaactattggaaagcagctgcttaaggggtcagctgatcctctgaacagtgct
ttccatctgacctataacatggttttgaacttactaagagtagaagaaattaaccccgag
tacatgcttgaaaaatccttctaccagtttcagcattatagagcaattccaggggtcgta
gaaaaggtaaagaactcagaagagcagtataataaaatagtcattcccaatgaagaaaat
gtggtcatctattacaagattagacagcaacttgccaagctgggaaaagagattgaagaa
tatattcataaaccaaagtactgcttaccctttctacagccaggccgtttggtaaaggtg
aaaaatgaaggcgatgatttcggctggggagtagtagtgaacttctcaaaaaagtcaaat
gtcaagcccaattctggcgaactggatcccttgtatgtggtggaagtcctcctgcgctgt
agcaaggaaagcctgaagaactcagccaccgaggcagcaaagccagcgaagccagacgag
aaaggggagatgcaggttgttccagttttggtgcatctcctgtctgccatcagcactgtc
aggctctatattccaaaagaccttcgacctgtggacaacagacagagtgtcttaaaatcc
atacaggaagttcaaaggcgctttcccgacggcgttcctctgttagatccgatcgatgat
atgggcatccaagatcaaggactgaagaaagtcatccagaaagtagaggcctttgagcat
cgcatgtactcacacccactccacaatgatcctaacttggaaactgtttatacactgtgt
gaaagaaaggcccagattgcactagatatcaagtctgcaaagagagaactgaagaaggca
agaactgttctgcaaatggacgagctcaaatgccgcaagcgcgtgctgagacggctgggc
tttgcgacatcgtcggatgtcatagagatgaaaggacgggtggcttgtgaaataagcagt
gcggacgagctccttctaacggagatgatgttcaatgggcttttcaatgacctttcttca
gagcaggcaaccgcactgttaagctgttttgtgtttcaagagaattctagtgagatgccc
aaactaacagagcagttagctggaccactccgacaaatgcaggaatgtgctaaaaggatt
gcaaaagtttcagcagaggcaaagctggagattgatgaagaaacttacctaagctcattc
aagcctcacctgatggatgtggtgtatacctgggcaactggggccacatttgcccatatc
tgcaaaatgacagatgttttcgaaggcagtataattcgttgtatgaggcgtctggaagaa
ctgcttcgacagatgtgtcaagcagcaaaagccattggaaacacagagctggagaacaaa
tttgctgaaggaattaccaaaatcaagagggatattgtatttgctgccagcctctactta
tag

DBGET integrated database retrieval system