KEGG   Mus musculus (house mouse): 74012
Entry
74012             CDS       T01002                                 
Symbol
Rap2b, 4021402C18Rik
Name
(RefSeq) RAP2B, member of RAS oncogene family
  KO
K07838  Ras-related protein Rap-2B
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    74012 (Rap2b)
   04031 GTP-binding proteins [BR:mmu04031]
    74012 (Rap2b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   74012 (Rap2b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    74012 (Rap2b)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 MMR_HSR1_Xtn FeoB_N MeaB
Other DBs
NCBI-GeneID: 74012
NCBI-ProteinID: NP_082988
MGI: 1921262
Ensembl: ENSMUSG00000036894
UniProt: P61226 Q6ZWR0
Position
3:61271928..61276124
AA seq 183 aa
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL
EGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC
VIL
NT seq 552 nt   +upstreamnt  +downstreamnt
atgagagagtacaaagtggtggtactgggctcgggcggcgtgggcaagtccgcgctcacc
gtgcagttcgtaacaggttccttcatcgagaagtacgacccgaccatcgaggacttttac
cgcaaggagatcgaggtggactcgtcgccgtcggtgctggagatcttggacaccgcgggc
acggagcagttcgcctcaatgcgggacctgtacatcaagaatggccagggcttcattctc
gtctacagcctggtcaaccagcagagcttccaggacatcaagcccatgcgggaccagatc
atccgcgtgaagcggtacgagcgcgtacccatgatcctggtaggcaacaaggtggacttg
gagggtgaacgtgaggtctcctatggcgagggtaaggccctggccgaggagtggagctgc
cccttcatggagacatcggccaaaaacaaagcctcagtggatgagctattcgcagagatc
gtgaggcagatgaactacgcggcacagcccaacggcgacgagggctgctgctcggcctgc
gtgatcctgtga

DBGET integrated database retrieval system