KEGG   Mesorhizobium opportunistum: Mesop_6100
Entry
Mesop_6100        CDS       T01542                                 
Name
(GenBank) CagE, TrbE, VirB component of type IV transporter system, conserved region
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mop00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mesop_6100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mop02044]
    Mesop_6100
Enzymes [BR:mop01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Mesop_6100
Secretion system [BR:mop02044]
 Type IV secretion system
  Trb secretion system protein
   Mesop_6100
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_22 HerA_C AAA_16 TraG-D_C ABC_tran AAA_29 DUF87 AAA_7 FtsK_SpoIIIE RsgA_GTPase
Other DBs
NCBI-ProteinID: AEH90502
UniProt: F7Y1E6
Position
complement(6262423..6264864)
AA seq 813 aa
MLNLSEYRGKADRLADHLPWAALVAPGIVLNKDGSFQRSFGFRGPDLESATEAELIGICA
RANNALRRLGSGWALFFEAERIEALGYPSSRFPDAASWLVDEERRAAFQGKVAHYESRYH
LTLTFMPPPDSQARAQSALVDSHHSGGEREWRQELTRFRDETGRVLDLLSGFMPEIRALD
DAETLTYLHGTISTRRHPVAAPETPIYLDGILVDAPLTGGLEPMLGNHHLRTLTILGFPN
VTRPGILDALNHQDFPYRWMTRFIPLDKTEATRTLTRLRRQWFAKRKSIVAILREVVTSE
PVPLVDTDAENKALDADAALQALGGDHVGFGYLTTTVTVWDEDHQAAAGKLRAVERVVNG
LGFATIREGVNAVEAWLGSLPGHVYANVRQPLVHTLNLAHLMPLSSVWAGPAANEHLAKV
TQAEAPPLLFASTSGSTPFRLSTHVDDVGHMLIVGPTGAGKSVLVALFALQFRRYAGAQV
YVFDKGNSARAAILAMGGEHHALRAHGALAFQPLRKIDDPAIRSWAAEWIAGLIAHENVT
VTPEAKEAIWSALTSLATAPAQERTLTGLSVLLQSNALKSALMPYTLDGPFGRLLDADDD
RLALSDVQCFETEELMHSQGAVLPVLTYLFHRLEARFDGRPTLLMLDEAWLYLDNPLFAG
RIREWLKVLRKKNVSVIFATQSLADVAGSAIAPAIIESCPQRIFLPNDRAVEPQAREAYE
RFGLNERQIELVARATPKRQYYLQSRRGNRLFQLGLGPIALALCGASDPASQTQIDRILS
EHGQDGFAFHFVNARGLYWAAELLRQFPQPDME
NT seq 2442 nt   +upstreamnt  +downstreamnt
atgctgaatctctccgaatatcggggcaaggccgaccgacttgccgatcatctgccttgg
gccgcactggtggcaccgggcatcgtgctcaacaaggacggaagtttccagcgctcattt
ggatttcgcgggcctgatctcgagagtgcaacagaagccgaactcatcggcatctgcgcg
cgggccaacaatgcgctcagacggctcggctccggctgggcattgttcttcgaagccgag
cgcatcgaggcgctgggctacccaagctcgcgtttccccgacgctgcgtcatggttggtc
gatgaagaacggcgcgcggcctttcaaggcaaggtcgcgcactacgagagccgctatcac
ctgacgctgacattcatgccgccgccggacagccaggcgcgggcgcaaagcgctctggtc
gactcgcatcattccggaggcgagagagagtggcgccaggaactcacgcggttccgggac
gagaccggtcgcgtgctggatctcctgtcaggcttcatgcccgaaatacgcgcactcgat
gatgccgagacgctgacttacctccacggcacgatctccacccgccgccatccagtcgcc
gcgccggaaacgccgatctatctcgacggcatcctggtcgatgcgccgcttaccggcggc
ttggagccgatgcttggcaaccaccatctgcgcacgctcacaatcctcggttttccgaat
gtcacacggcccggaattctcgacgcgctcaaccatcaggatttcccctaccgctggatg
acgcgcttcattccgctggacaagaccgaggccaccaggacgctgacgcggttgcggcgg
cagtggtttgccaagcgcaaatcgatcgtggccatcctgcgcgaggtggtgaccagcgaa
cccgtcccgctcgtcgacaccgatgccgaaaacaaggcgctcgatgccgacgccgcactc
caggcgttaggcggcgatcatgtcgggttcggctatctgacgacgacggtgacggtttgg
gacgaggaccatcaagccgctgcggggaaactccgcgcggtcgagcgcgtcgtcaatggc
ctcggcttcgccacgatccgtgaaggcgtgaatgcggtcgaggcctggctcggctcgttg
cccggccatgtctatgccaatgtccgtcagccgctcgttcacacattgaacctcgcccac
ttgatgccgctttcctcggtgtgggccggcccggcggcgaacgagcatctcgccaaagtt
acacaggcagaggccccgccgcttctgttcgcctcaaccagcgggtcgacaccgttccgg
ctttccacccacgtcgacgatgtcggccacatgctgatcgtcggaccgaccggcgccggc
aaatcggttctcgttgccctcttcgctctgcagttccgacgctatgccggcgcgcaggtc
tatgtcttcgacaaaggcaattcagcccgggccgcaattcttgccatgggtggcgagcat
cacgcgctgcgcgcgcacggtgcgcttgccttccagccgctgcgcaagattgacgatccg
gcgatccgcagctgggcagccgaatggatcgccgggctgatcgcccatgagaacgtcacc
gtcaccccggaggcgaaagaggcaatctggtcggcactcaccagtcttgcaacggcgccg
gcgcaggaacgcacactcaccggcctgtcggtcttgcttcagtccaacgcgctgaagtcc
gctttgatgccctacacgctcgacgggcccttcggccggttgctggacgcggatgacgat
cggctggccttgtcggatgtgcagtgcttcgagaccgaagagctgatgcacagccaaggc
gctgtgctgccggtgctcacctatcttttccatcgcctcgaggcgcggttcgatggacga
ccgacattgctcatgctcgacgaggcctggctctatctcgacaatccgctctttgcgggg
cgtatacgcgaatggctgaaggtgctgcgcaagaagaacgtctcggtcattttcgccacg
cagtcactggccgacgtcgctggctctgcaatcgcaccggccatcatcgagagctgccca
cagcgcatctttcttcccaatgaccgtgccgtggaaccacaggcacgggaagcctacgag
cgtttcggcctgaacgagcggcagatcgagcttgtcgcgcgcgccacgccgaagcggcaa
tattatctgcaatcgcgccgcggcaaccggctgtttcagctgggcttgggcccaatcgcg
cttgcgctatgcggcgcctccgatccggccagccagacccagatcgacaggatcctgtcg
gaacacggacaggacggctttgcctttcatttcgtgaatgcccgcgggctctattgggcc
gccgagcttctccgccaattccctcaaccagacatggagtaa

DBGET integrated database retrieval system