KEGG   Mus pahari (shrew mouse): 110319567
Entry
110319567         CDS       T05929                                 
Symbol
Hras
Name
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110319567 (Hras)
   04012 ErbB signaling pathway
    110319567 (Hras)
   04014 Ras signaling pathway
    110319567 (Hras)
   04015 Rap1 signaling pathway
    110319567 (Hras)
   04370 VEGF signaling pathway
    110319567 (Hras)
   04371 Apelin signaling pathway
    110319567 (Hras)
   04630 JAK-STAT signaling pathway
    110319567 (Hras)
   04068 FoxO signaling pathway
    110319567 (Hras)
   04072 Phospholipase D signaling pathway
    110319567 (Hras)
   04071 Sphingolipid signaling pathway
    110319567 (Hras)
   04151 PI3K-Akt signaling pathway
    110319567 (Hras)
   04150 mTOR signaling pathway
    110319567 (Hras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110319567 (Hras)
   04140 Autophagy - animal
    110319567 (Hras)
   04137 Mitophagy - animal
    110319567 (Hras)
  09143 Cell growth and death
   04210 Apoptosis
    110319567 (Hras)
   04218 Cellular senescence
    110319567 (Hras)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110319567 (Hras)
   04540 Gap junction
    110319567 (Hras)
   04550 Signaling pathways regulating pluripotency of stem cells
    110319567 (Hras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110319567 (Hras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110319567 (Hras)
   04650 Natural killer cell mediated cytotoxicity
    110319567 (Hras)
   04660 T cell receptor signaling pathway
    110319567 (Hras)
   04662 B cell receptor signaling pathway
    110319567 (Hras)
   04664 Fc epsilon RI signaling pathway
    110319567 (Hras)
   04062 Chemokine signaling pathway
    110319567 (Hras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110319567 (Hras)
   04929 GnRH secretion
    110319567 (Hras)
   04912 GnRH signaling pathway
    110319567 (Hras)
   04915 Estrogen signaling pathway
    110319567 (Hras)
   04917 Prolactin signaling pathway
    110319567 (Hras)
   04921 Oxytocin signaling pathway
    110319567 (Hras)
   04926 Relaxin signaling pathway
    110319567 (Hras)
   04935 Growth hormone synthesis, secretion and action
    110319567 (Hras)
   04919 Thyroid hormone signaling pathway
    110319567 (Hras)
   04916 Melanogenesis
    110319567 (Hras)
  09156 Nervous system
   04725 Cholinergic synapse
    110319567 (Hras)
   04726 Serotonergic synapse
    110319567 (Hras)
   04720 Long-term potentiation
    110319567 (Hras)
   04730 Long-term depression
    110319567 (Hras)
   04722 Neurotrophin signaling pathway
    110319567 (Hras)
  09158 Development and regeneration
   04360 Axon guidance
    110319567 (Hras)
  09149 Aging
   04211 Longevity regulating pathway
    110319567 (Hras)
   04213 Longevity regulating pathway - multiple species
    110319567 (Hras)
  09159 Environmental adaptation
   04714 Thermogenesis
    110319567 (Hras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319567 (Hras)
   05206 MicroRNAs in cancer
    110319567 (Hras)
   05205 Proteoglycans in cancer
    110319567 (Hras)
   05207 Chemical carcinogenesis - receptor activation
    110319567 (Hras)
   05208 Chemical carcinogenesis - reactive oxygen species
    110319567 (Hras)
   05203 Viral carcinogenesis
    110319567 (Hras)
   05230 Central carbon metabolism in cancer
    110319567 (Hras)
   05231 Choline metabolism in cancer
    110319567 (Hras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110319567 (Hras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110319567 (Hras)
   05225 Hepatocellular carcinoma
    110319567 (Hras)
   05226 Gastric cancer
    110319567 (Hras)
   05214 Glioma
    110319567 (Hras)
   05216 Thyroid cancer
    110319567 (Hras)
   05221 Acute myeloid leukemia
    110319567 (Hras)
   05220 Chronic myeloid leukemia
    110319567 (Hras)
   05218 Melanoma
    110319567 (Hras)
   05211 Renal cell carcinoma
    110319567 (Hras)
   05219 Bladder cancer
    110319567 (Hras)
   05215 Prostate cancer
    110319567 (Hras)
   05213 Endometrial cancer
    110319567 (Hras)
   05224 Breast cancer
    110319567 (Hras)
   05223 Non-small cell lung cancer
    110319567 (Hras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110319567 (Hras)
   05170 Human immunodeficiency virus 1 infection
    110319567 (Hras)
   05161 Hepatitis B
    110319567 (Hras)
   05160 Hepatitis C
    110319567 (Hras)
   05163 Human cytomegalovirus infection
    110319567 (Hras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110319567 (Hras)
   05165 Human papillomavirus infection
    110319567 (Hras)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110319567 (Hras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110319567 (Hras)
   05022 Pathways of neurodegeneration - multiple diseases
    110319567 (Hras)
  09165 Substance dependence
   05034 Alcoholism
    110319567 (Hras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110319567 (Hras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110319567 (Hras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110319567 (Hras)
   01522 Endocrine resistance
    110319567 (Hras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110319567 (Hras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110319567 (Hras)
   04031 GTP-binding proteins [BR:mpah04031]
    110319567 (Hras)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    110319567 (Hras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110319567 (Hras)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110319567 (Hras)
  Exosomal proteins of colorectal cancer cells
   110319567 (Hras)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110319567 (Hras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N
Other DBs
NCBI-GeneID: 110319567
NCBI-ProteinID: XP_021050707
Ensembl: MGP_PahariEiJ_G0013880
Position
1:complement(110536922..110541666)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
ATRTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG
CMSCKCVLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatacaagcttgtggtggtgggcgctggaggcgtgggcaagagtgccctgacc
atccagctgatccagaaccactttgtggacgagtatgatcccaccatagaggactcctac
cggaaacaggtggtcattgatggggagacatgtctactggacatcttagacacagcaggt
caagaagaatatagcgccatgcgggaccagtacatgcgcacaggggagggcttcctctgt
gtatttgccatcaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc
aagcgggtgaaagattcagatgatgtgccaatggtgctggtgggcaacaagtgtgacctg
gccactcgcactgttgagtctcggcaggcccaggaccttgctcgcagctatggcatcccc
tacattgaaacatcagccaagacccggcagggtgtggaggatgccttctatacgctagtc
cgtgagattcggcagcataaactgcggaaactgaacccgcctgatgagagtggtcctggc
tgcatgagctgcaagtgtgtgttgtcctga

  All links  
Ontology (4)   
   KEGG BRITE (4)   
Pathway (84)   
   KEGG PATHWAY (84)   
Genome (1)   
   KEGG GENOME (1)   
Gene (4)   
   KEGG ORTHOLOGY (1)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
   Ensembl (1)   
Protein sequence (3)   
   RefSeq(pep) (3)   
DNA sequence (3)   
   RefSeq(nuc) (3)   
Protein domain (11)   
   Pfam (11)   
All databases (110)   

Download RDF
DBGET integrated database retrieval system