KEGG   Methylorubrum populi: Mpop_3089
Entry
Mpop_3089         CDS       T00760                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
mpo  Methylorubrum populi
Pathway
mpo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mpop_3089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpo02044]
    Mpop_3089
Enzymes [BR:mpo01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Mpop_3089
Secretion system [BR:mpo02044]
 Type IV secretion system
  Trb secretion system protein
   Mpop_3089
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_29 FtsK_SpoIIIE ABC_tran TrwB_AAD_bind HerA_C TraG-D_C AAA_16 AAA_23 DUF87 Zot
Other DBs
NCBI-ProteinID: ACB81244
UniProt: B1ZGL0
Position
3312572..3315010
AA seq 812 aa
MMNLAEYRDRNSRLADFLPWVALVGSGLVLNKDGSFQRTARFRGPDLDSAVAAELVAVAG
RLNNAFRRLGSGWAIFVEAQRHPSNHYPDSHFPDAASALVDAERKAGFEEAGAHFESSYF
LTFTYLPPAEDAARAESWLYEGREQRGLDPHEALGGFTDRTDRLLRLIEAFMPECRWLDD
GETLTYLHGCVSTHRHRVRVPETPMYLDALLADQPLTGGLEPRLGQAHLRVLTVTGFPTA
TTPGLLDELNRLAFPYRWSTRAVLLDKTDATKLLTKIRRQWFAKRKSVAAILKEVMTNEA
SVLVDTDASNKAADADLALQELGADYAGIAYVTATVTVWDADPRVADEKLRLVEKVIQGR
DFTAMAETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFAAPP
LLFGKTEGSTPFRFSLHVGDVGHTLIVGPTGAGKSVLLALMALQFRRYADAQVFAFDFGG
SIRAAALAMGGDWHDLGGDLSDSAATSVSLQPLAHIHDVSERAWAADWIGAILTREAVAI
TPEVKEHIWTALTSLASAPVEERTVTGLTVLLQSNDLKQALRSYCIGGPYGRLLDAEREH
LGTATVQAFETEGLIGTGAAPAVLSYLFHRIEDRFDGSPALLIIDEGWLALDDDGFAGQL
REWLKTLRKKNASVIFATQSLSDIDGSVIAPAIIESCQTRLLLPNERAIEPQITAIYRRF
GLNDRQIEIIARAMPKRDYYCQSRRGNRLFELGLSDVALALCAASSKTDQSAISRLFAEH
GRAGFLAAWLRHRDVGWAADLIPTLTKTEKLP
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgatgaacctcgccgaatatcgcgaccgtaatagccggctcgccgacttcctgccctgg
gtggcgctggtcggctcaggtctcgtgctcaacaaggacggcagcttccagcgcacggcg
cgctttcgcggtcccgacctggattccgcagtcgcggcggagctggtcgcggtcgccggc
cggctcaacaacgccttccgtcgtctcggctcaggctgggcgattttcgtggaagcgcag
cgccatccctcgaaccactatcccgacagccattttccggatgccgcatcggcgttggtc
gacgccgagcgcaaggccggtttcgaggaagctggagcgcatttcgagtccagctacttc
ctcaccttcacctacctgccgccggccgaggatgccgcccgtgcagaaagctggctctat
gagggccgtgaacagaggggcctcgatccgcacgaggctctgggtggcttcaccgaccgc
accgaccggcttctgcgcctcatcgaagccttcatgcccgaatgccgctggctcgatgac
ggcgaaacgctgacctacctgcatggatgcgtttcgacgcaccggcatcgcgtccgcgtt
cccgaaacgccgatgtatctcgacgcgctgctcgccgatcagccgctcaccggcggtctg
gagccgcgccttgggcaggcacatctgcgcgttctcaccgtcaccggattcccgaccgcg
acgacaccgggcctgctcgacgagctgaaccggctggctttcccctatcggtggagcacg
cgcgcggtcctgctcgacaagaccgacgcgaccaagctgctgaccaagatccggcgccaa
tggttcgccaagcgcaaatcggtcgccgcgatcctcaaggaggtgatgaccaacgaagcg
tccgtccttgtcgacacggacgcatcgaacaaggcggcggacgccgatctcgcgcttcag
gagctgggcgccgactatgccggcatcgcctatgtcacggcgacggtgacagtgtgggac
gctgatccgcgcgttgccgacgagaaactgcggctggtcgagaaggtcatccagggccgc
gacttcaccgcgatggcggaaaccatcaacgcggtggacgcctggctcggcagtcttccc
gggcatgtttacgccaatgtgcggcaaccgccgatctccaccctcaatctcgcccacatg
atccccctgagcgccgtgtgggcggggccggaacgggacgagcatttcgcagcgcccccg
ctgctgttcggtaaaaccgaaggctcgaccccgttccggttttctcttcacgtcggcgat
gtcggccatacgctgatcgtcggcccgaccggcgcgggcaaatccgtgctgctggcgctc
atggcgctccagtttcgccgctatgccgacgcccaggtgttcgctttcgattttggcggt
tcgatccgggcggcggccctcgccatgggcggtgactggcacgacctcggcggggatctc
agcgacagcgccgcgacgagcgtcagtcttcagccactggctcatatccacgacgtctcc
gagcgcgcctgggccgccgattggatcggcgccatcctgacgcgcgaagcggtcgccatc
acgccagaagtgaaggagcacatctggacggcgttgacctcgctggcctcggcgccggtc
gaggaacgcaccgtcaccggcctcaccgttctgctccagtccaacgacctgaagcaggcg
ctgcgttcctattgcatcggcggcccctatgggcggctgctcgacgccgaacgggaacat
ctcggcacggcgacggtccaggcgttcgagaccgaagggctgatcggtaccggcgcggcg
cccgcggttctctcctatctctttcaccgcatcgaggaccgcttcgacggatcgccggcc
cttctcatcatcgacgaggggtggctcgcgctggacgacgacggctttgccggtcagctc
cgcgaatggctgaagacgctgcgtaagaagaacgccagcgtcatcttcgccacgcagagc
ctgtcggacatcgatggctcagtcatcgcgcccgccatcatcgaaagctgccagacccgc
cttctgctcccgaacgagcgcgccatcgaaccgcagatcacggcgatctaccggcgcttc
ggcctcaacgaccgccagatcgagatcatcgcgcgcgccatgcccaagcgcgactattac
tgccaatcccggcgcggcaatcgcctgttcgagctggggctgtcggacgtcgccctcgcg
ctctgcgccgcttcctcgaaaaccgaccaatccgcgatctcgcggctgttcgccgagcac
gggcgggccggcttcctcgccgcctggctccgccaccgcgacgtcggctgggcggctgat
ctcatcccgacgctcaccaaaacggagaaactgccatga

DBGET integrated database retrieval system