KEGG   Nitrosomonas eutropha: Neut_0098
Entry
Neut_0098         CDS       T00393                                 
Name
(GenBank) conserved hypothetical protein
Organism
net  Nitrosomonas eutropha
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB
Other DBs
NCBI-ProteinID: ABI58386
UniProt: Q0AJT5
Position
complement(94276..96450)
AA seq 724 aa
MAQTQPVEVLLRPAVELYTVAVCTGAAILCVVAPWALALNLDIGIGSALAFAVFGAIRFR
QAQAILRYRRNIRRLPRYVMTSRDVPVSQQRLFIGKGFLWEQKHTHRLTQTYRPDFRRYV
EPTSAYRLARRLEERLEFAPFPLSRLAQLTAWDVPLNPVRPLPPVGGLPRLHGIEPHEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFITQDIRRKNHVGEHEVVIVFDPKGDADLLKR
MYVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNIVARALIELGQRPDYLLIQRHVVNIDALFIEYAQHYFAKTEPKAWEVIVQLEAR
LNDRNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLNDPRPIFDWMQIIRKRAVVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKFGIDDGLPGANAGQKVPINLHADEFNELMGDEFIPMINKGGGAGIQVTAY
TQTLSDIEARLGNRAKAGQVIGNFNNLFMLRVRETATAELLTKQLPKVEVYTTTVVSGAT
DSSDIHGKTDFTSNTQDRISMTSVPMIEPAHIVQLPKGQCFALMQGGALWKVRMPLPAPD
PDENMPQDLQQLAEYMRQSYTETGQWWENTGIPGLQEQSLPDTLLDDEPVDAASGSAEDN
EAAP
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcgcagacccagccggttgaggtattgctgcgtcccgccgtggagctatacaccgtg
gcggtctgtaccggcgccgcgattttgtgcgtggtggccccgtgggcgctcgcgctgaac
ctagatattggtatcggtagcgctctggcgttcgctgtcttcggtgccattcggtttcga
caggcacaggcgatattgcgctaccgccgcaacattcgacgtctgccacgttatgtgatg
accagccgcgatgtgccggtcagccagcagcggctgttcatcggcaagggctttttgtgg
gaacagaagcatacgcataggctgacgcagacataccggcctgattttcgccgctacgtc
gagccgacttcggcttatcgactggcgcggcgcttggaagaacgtttggagttcgcgcca
tttcccttatctcgtttggcgcagcttacggcatgggatgtgccattgaatccagtgcgc
ccactgccgccggtcggcggtttgccgcggttgcatggcatcgagccgcatgaagtggac
gtcagcctgcccttaggggaacgcgtcggtcattcgttggtgctgggcaccacacgggtg
ggcaaaacgcggttagctgagctttttatcacccaggacattcgacgcaagaaccacgtg
ggtgaacatgaggtcgtcattgtcttcgatccgaagggcgatgccgatttgctcaaacgc
atgtacgtggaggccaaacgcgccgggcgagaaggcgagttttatgtgtttcacctaggt
tggccggacatatccgcgcgttacaacgcggttggccgattcggacggatttccgaagtg
gccacccgcattgcgggccagctctcgggcgagggcaactcggcggcgttccgagaattt
gcttggcgcttcgtcaatatcgtcgcgcgtgcgctgatcgaactgggacagcgcccggat
tatctgttgatccaacggcacgtggtcaacatcgatgcgctgttcatcgagtatgcccag
cattatttcgccaagaccgaacccaaagcctgggaggtcatagttcaacttgaagcacga
ctaaacgacaggaacatccccaggaacatgatcggacgcgagaagcgtgtggtcgcgctg
gagcagtacctgagccaagcgcgaaactacgacccggtactggacggtctgcgtagcgcc
gttcgctacgacaagacgtatttcgacaagatcgtggcaagcctcttacccctgctggaa
aagctcaccagcggcaagatcgctcaactactcgcgccaaactactcggacctgaacgac
cccaggccaatcttcgactggatgcaaatcatccgcaaacgggcggtggtctatgtgggt
ctggatgcgctgtccgatgccgaggtcgccgcggcggtgggtaactccatgttttctgac
ttggtatcggtggcgggccacatttacaagttcggcattgacgatggcctgcctggggcc
aatgcgggtcagaaggtgccgatcaacctgcatgcggacgaattcaacgaactcatgggc
gatgaattcatcccgatgatcaataaaggaggcggggctggcattcaggtcaccgcctac
acgcagactctgtctgacattgaagcgcgtcttggcaatcgcgccaaggcgggtcaagtg
atcggcaacttcaacaatctattcatgttgcgcgtgcgcgagacggcgacggccgagcta
ctgaccaagcaattacccaaggttgaggtctacaccaccacggtcgttagcggcgccacc
gacagctctgatattcacggtaaaaccgactttaccagcaacactcaggatcgcataagc
atgaccagtgtgccgatgatcgaacccgcgcatatcgtccagctccccaaaggccagtgt
ttcgcgttgatgcagggcggggcactttggaaggttcgtatgccgttgccagcgcctgat
cccgacgagaacatgccgcaggatttgcagcagctcgccgagtacatgcgccagagctat
acagaaaccggtcagtggtgggaaaataccggcatccctgggttgcaggagcaatcgctg
cccgatacgctgctggacgacgagcccgtggatgcggcaagcggcagcgccgaggacaat
gaggcagcgccatga

DBGET integrated database retrieval system