KEGG   Numida meleagris (helmeted guineafowl): 110398567
Entry
110398567         CDS       T06015                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110398567 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nmel03000]
    110398567 (MECOM)
Transcription factors [BR:nmel03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    110398567 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED Zn-ribbon_8 zf-C2H2_11 zf-met zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 110398567
NCBI-ProteinID: XP_021252011
Position
4
AA seq 1052 aa
MKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQK
KLENENDLRDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLLPTSSPVKGLPSTDQTNKSQSPLMTNPQILPATQDILKALNKQ
PSVGENKPVELQPERSSEERPHEKLSDQSESSDLDDVSTPSGSDLETTSGSDLESDIESE
KEKFKENGKMFKDKVSSLQSLASINNKKEHSNHSIFSPSLEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQSPS
ELKKIPKGSSESPFDLTTKRKEEKPVTPIPSKPAAPPAASQDQPLDLSMGSRSRASGTKQ
AEPRKNHVFGEKKGGDLEQRKTSEASLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQFQLPDQRIWMSAIENMAEKLESFSALKPEASEMIQSMPSMFNFRAPPSA
LPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHV
RNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE
DSYFTEIRNFIGNSNHNNQSPRNSEDRMNGSHFKDEKAMVTSQNSDLLDDEEAEDEVMMD
EEDEESEIAGKTVKEPVTSDMHEGTPEEDYEETSTLDMNCKASPGRYKEEEYNKTGLSAL
DHIRHFTDSLKMRKMEENQYSEAELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLSDKD
SLHSASHNSPNMWHSMARAAAESSAIQSISHV
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcacatgaaacaatggctccggacattcacgaggagcgccag
tatcgctgcgaggactgcgaccagctctttgagtccaaggctgagctggtagaccaccag
aagttcccctgcagcacaccgcactccgccttctccatggtggaagaggacttccagaaa
aagcttgagaatgagaatgaccttcgggatgtgcacgaaatccaggagtgcaaagagtgt
gatcaagtcttcccagacttacaaagcctggagaagcacatgctgtcccacagcgaggag
cgggagtacaagtgcgaccagtgccccaaggctttcaactggaagtccaacttgatacgt
caccaaatgtcgcatgacagcggcaagcactatgagtgtgagaactgtgccaaggttttc
acggaccccagcaacctccagaggcacattcgttcccagcatgttggggctcgtgctcac
gcttgtccagagtgtggcaaaacctttgccacatcttcaggcctcaaacagcataaacac
atccacagcagtgtcaaaccctttatatgtgaggtctgccataaatcctatactcagttt
tcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgtgag
ggcaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgctgac
tattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccccggtctgtttccttcaggcttgtaccacaggccacctttgctacctact
agctctcctgttaaaggactgccaagcacagatcagacaaacaaaagtcaaagtcccctc
atgaccaaccctcagatactgccagccacccaggatattttgaaggcactaaataagcaa
ccatctgtaggggaaaataagccagtggagcttcaaccagagaggtcctctgaagagagg
ccgcatgagaaactcagtgaccagtcagagagtagtgaccttgacgatgtcagtaccccc
agtggcagtgacctggaaaccacctctggctctgatctggaaagtgacattgaaagtgag
aaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctctctgcagagt
ttggcttcaataaataataagaaagaacacagcaatcattccattttctcaccatcttta
gaggagcagactgcggtgtcaggagcggtgaatgattctataaaggctattgcttctatt
gctgaaaaatactttggttcaacaggacttgtggggctgcaagacaaaaaagttggagcc
ttaccttacccttccatgtttcccctcccattttttccagcattctctcagtcaatgtat
ccatttcctgatagagacttgagaccgttacccttgaaagtggagccccaatcacccagt
gaactcaagaagatcccaaagggaagctctgagtctccctttgacctcaccactaagcgt
aaggaggagaagcccgttactcccataccctcaaagccagcagctccgcctgcggcaagc
caggaccagcctctagatctgagcatgggcagtagaagtcgagccagcggcacaaaacag
gccgagccccggaagaaccacgtctttggcgagaagaaaggaggagacctcgagcagagg
aaaacgtcggaggcctctttgcagcacgcccgaccgactcccttcttcatggatcccatt
tacagagtagagaaaagaaagttaactgaccctctcgaagctttaaaagagaaatacttg
agaccttccccgggattcttgtttcatccacaattccaattgcctgatcaaagaatttgg
atgtcagctatagaaaacatggccgaaaagctggagagtttcagtgccttgaagccggag
gccagcgagatgatccagtcaatgccatccatgttcaacttccgagccccgccaagcgcc
ctgcccgagaccctcctgcgcaagggcaaggagcgctacacctgcagatactgtggcaag
attttccccagatcggcaaacctaacccgtcacctgaggacgcacactggagagcagccc
tacagatgcaaatactgtgacaggtccttcagcatatcttccaacctgcagagacacgtc
cgtaatatccacaataaagaaaagccattcaagtgtcacttgtgtgacaggtgttttggt
caacaaaccaatcttgacagacatctaaaaaagcatgagaatggcaacatgtctggtact
gcaacatcttcacctcactcagaactggaaagcacaggggccatcctagacgacaaggaa
gattcttacttcacagaaattaggaattttattggaaacagcaaccacaacaatcaatcc
ccccgaaactcagaggacagaatgaatggcagccactttaaggatgaaaaagccatggta
accagccagaactcagatttgttggatgacgaagaggcagaagatgaagtaatgatggac
gaagaagatgaagaaagtgaaattgcagggaaaacagtcaaagagcctgtcaccagtgac
atgcacgaggggactcctgaggaggattacgaggaaacgagtactttggacatgaactgc
aaagcttcccctggcaggtataaagaggaggagtataataagactggactttcagctttg
gaccacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaatcaatat
agtgaagctgaattggcagctttcaatacttcccagctgccagaggacctaaaacaacca
ttgtacaggaaatccaaatcccaggcgtatgccatgatgctctctctctccgacaaggac
tcccttcattctgcatcccacaattctcccaatatgtggcacagtatggcgagagctgct
gcagaatccagcgccatccaatccatcagtcacgtatga

DBGET integrated database retrieval system