KEGG   Nasonia vitripennis (jewel wasp): 100119257
Entry
100119257         CDS       T01081                                 
Name
(RefSeq) pancreatic triacylglycerol lipase isoform X1
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00561  Glycerolipid metabolism
nvi01100  Metabolic pathways
Module
nvi_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100119257
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     100119257
SSDB
Motif
Pfam: Lipase Abhydrolase_6 Abhydrolase_1 Hydrolase_4 BD-FAE Abhydrolase_2
Other DBs
NCBI-GeneID: 100119257
NCBI-ProteinID: XP_008212236
NASONIABASE: NV17120
UniProt: A0A7M7HAJ9
Position
1
AA seq 564 aa
MMRRRGVRKQGNSECEGALVLLLVALAPVICSAGILDPWQWARSDRIEVNIPWLPFENET
RCYDELGCLNITRSWYHLIHRPLNVFPLPREVINTRFILYTNDNPTEGQVLIVGKDKSIK
RSNFSPKRKTKFIIHGFIDTPLSNWVKEMRNELLKHGDYNVIIVDWAGGSLPLYTQATAN
TRLVGLEIAHLVKHLQNNYGLDPSDVHLIGHSLGAHTAGYAGEKLNGNIGRITGLDPAEP
YFQGMPSHLRLDYTDAQLVDVIHTDGKSIFFLGLPGYGMSQPCGHLDFYPNNGKEQPGCT
DLSETTPSLPLTLIREGLEEASRVLVACNHVRAIKLFIESINSKCQYVAHECGSYASFLR
GECFSCKSNNSLSCGIMGYHADSSPALVRRQQMGQDVSALLGSKFFFSTGKDDPYCRRHY
RITINLARPPTAESWVQGYMKVTLHADNGVIRNMDLTPSGYMKLEHGTTTRMVVAHPGGS
TGEIGKIRRVELSWAYDMDVLQPRSLCFFWCNDRLYVNSVVVDIMELPGRGKRETDLSSK
LCSASRQDFAEIASGSTASFTDSC
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgatgaggaggagaggcgtgagaaaacaaggaaactccgagtgcgaaggagctctggtc
ctactcctggtggcattggctcctgttatctgctccgctggaatcctggacccgtggcaa
tgggcgcgcagcgacagaatagaagtcaatatcccttggctacccttcgaaaacgagaca
cgatgctacgacgagctgggctgcttgaacatcaccaggagctggtaccatctgattcac
cgacctctcaatgttttcccgctgccgcgggaggtcatcaacactcggtttatactttat
accaatgacaatcccaccgaaggccaagtcttaatcgtaggaaaggacaagtccatcaag
cgctcgaacttcagtccgaagcgaaaaaccaagtttattatacacggcttcatagacacg
ccgctcagcaactgggtgaaggagatgagaaacgagctgctcaagcacggcgactacaac
gtgataatcgtcgactgggccggtggcagtctacccctttacacacaggccaccgccaac
acgaggctagtgggactcgagatcgcgcatctcgtcaagcatctgcagaacaactacggc
ctggacccaagcgacgttcatctgatcggacacagtttgggggcccacacggctggttac
gccggcgagaagctcaacggtaacatcggccgtataaccggactcgatccggccgaacct
tacttccaagggatgcccagtcacctgcgactcgactacaccgacgcccaactcgtcgat
gtcatccataccgacggcaagagcatcttcttcttaggtcttccaggttacggcatgagc
cagccgtgcgggcacctggacttctacccgaacaacggcaaggagcagccgggctgcacc
gacctgagcgagacgacgccgtccttgccattgaccttgattcgcgaaggtctggaagaa
gcctcgcgagtcctggtggcctgcaaccacgtgcgagctatcaagctcttcatcgagagc
atcaacagcaagtgtcagtacgtagcccacgagtgtggcagctacgccagtttcctcagg
ggcgagtgcttctcctgcaagagcaacaacagcctcagttgcggaatcatgggatatcac
gcggacagcagtcctgctctggtgaggaggcagcagatgggacaggatgtgtcggctttg
ctgggctccaagttcttcttctctaccgggaaagacgatccttattgcagacgacactac
agaataacaatcaatttggccaggccacccacggctgagagctgggtgcagggatacatg
aaagtcacgcttcacgctgacaatggcgtgatacgtaacatggacttgactcccagcggc
tacatgaagttggagcacgggacgacgacgcgaatggtcgtggcacaccccggcggctcg
accggagaaattggcaaaatacgacgagtcgagttgtcgtgggcgtacgacatggacgtt
ctgcaacctcgatcattgtgcttcttctggtgcaacgaccgactctacgtgaacagtgtc
gtagttgatattatggaactaccgggcagggggaagcgcgagaccgacctctcgagcaag
ctgtgctcggcaagtaggcaggacttcgcggagatagccagcggttcgacggcctccttc
accgacagctgctga

DBGET integrated database retrieval system