KEGG   Nasonia vitripennis (jewel wasp): 100121303
Entry
100121303         CDS       T01081                                 
Name
(RefSeq) dynein heavy chain 2, axonemal
  KO
K10408  dynein axonemal heavy chain
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:nvi03037]
    100121303
   04812 Cytoskeleton proteins [BR:nvi04812]
    100121303
Cilium and associated proteins [BR:nvi03037]
 Motile cilia and associated proteins
  Dynein arm
   100121303
Cytoskeleton proteins [BR:nvi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100121303
SSDB
Motif
Pfam: AAA_6 DHC_N2 DHC_N1 AAA_8 Dynein_C AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 Dynein_AAA_lid AAA_lid_1 AAA AAA_22 AAA_30 Sigma54_activat Spectrin DUF2200
Other DBs
NCBI-GeneID: 100121303
NCBI-ProteinID: XP_008209980
NASONIABASE: NV16466
UniProt: A0A7M7H5X5
Position
4
AA seq 4324 aa
MLGLTVIYQPREACELIAEEASADKELVKRLEGVVVHWLRQIRIALGDQDQSTVGELLCF
KDEYDFWLYRYDNLRGLRQQLETKCSRGVLSVLGLAHSTHLRQLQLLIEEIERATREAKS
NVEFLAMLEEPCLRGLGDSRRPIDLLDRLAEVIQISRVIWMNSPYLGNERRMTRLFEVIG
NQVIEVCRNAVNLDELFSGMTRKTMEMLLESIDVCQRYKDLYHEISRAHNKLTHHKWELR
SEQVFRYVDAFVVRCQNLVEISQAMIDFARMDETNEMPRIRFNGTKGPEHERMCLKIEQR
FSELLSWLRRISPKILDVRQSTWYDDMSLFRSEIRKLELAVENLMEDAFEEAGNIEDSLQ
TLHGFRYFMRRENLQKQFDMKIGIIWQMLDTEIQTTKQEIISEKSEYPSFSPYFAGRALN
LKMKSDRLTRLSLQLRECTWQRSGDPTGNEAHAKAFHHCNALVESIAGQIADLYRKWLAE
LGDNPQSRLDRYLMRRVSDACGADDKARLLECNVDPRLLSLCKEAGYWLDLRFELPVSVQ
LINGRWRSLQFVYENVLAIVGAYNKIIQALSDEEKPLFRELIRQVDKKIRPGLTKLTWKS
DYIEDYIKDCNTQTAKLQEFIDTYKKCNLEIFKICESICGVVMIKIRHNHVYELDELLDE
METSRNEAFDIFMEKYKLIVKYLLVVYEGFQPVIEHCLTEWKLYLLNFDKLLKEAFKLSI
KNSLLIMYESLHGDGTVSPSPILQLKADLVNNKINFTPSLTDVAQMVSNFFHKLLDLLKI
IPSVVEKFELHDFQTKPYWKAYLEDEDLDRSRQMSNNEVSYCFTQVQNYLTTWEPFRDIW
EVNKDLFIQRYEKLKPTVALFDADIGRYAEVANNVQMQETVVTVHFLEINVDRLKAAIVQ
QCSLWQQKLTGLLLELTEGKVHHIYKYVADNGKRITKEPMDLITMQAALQLFERLAAEIP
MEEKEFPTIRQQYETLEKYEVSMTLELKRKIRDLDECWTSYLELVAVCELTLLQKKEEFK
NKLIKEDNVLKENVKNLLQKFYESAPFTSDWKTKDARAWLQNMRKKVNKTRDQLNKLKKD
LSIFSISQPDSTELNTLLSELTALELVWELTDEWEAAWKRYKYGNFWSIEIDEMDETANV
LFRKLTRLSRELKEKNWSIVDSTRSRVDNFRRTLPLIIDLKNPAMRDRHWTKVMQSMGTD
FDQKSDEFTLDAIAAMQMHNFAEEIADISNSATMELAIETGLKNISEIWKAMPLIMVPYK
ENGIYRLKTVDDIMQALEEHQVQLSAMKSTKFVDAFAAEVDYWERALSTVGEILEMVLSV
QKSYMYLDNIFSAEDIRKQLPQETDDFDKLTASWKEITWRMASSKLALQATLEPPGLLDT
LNELNNKLEAIQRELEQYLETKRHVFPRFYFISNDDLLEILANSKKPELIQPHIKKLFDG
IKHIKLGKSVSGKAVAEGMSSSEGEYTEFLEPVLLEGQVEVWLCYIESAMRRTLREVLRQ
CRAALRKMSAKRDKWVKEWQSQSGITSTQIQWTSDCTRVLQQCKLLESKKPLKKLKKRQN
QALAKYSEAVRGKLDRLQRLKFKAIVVIEIHARDVIERMYKSNCRDVSSFEWLSQLRFYW
DRDVDDCVVRQTNTSFVYGYEYLGNSERLVITPLTDRCYITLTTALHLHRGGSPKGPAGT
GKTETVKDLGKALGFNVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSV
VAQQILSILTALSQKLTRFVFEGTEISLVSTCGIFITMNPGYAGRTELPDNLKSMFRPIS
MMVPDSSMIAEINLFGEGFQNTRSLAKKVDTLYALAKQQLSKQFHYDFGLRGIVTLTRYA
GKKRRQYPNLPDEEVVILAMKDMNIAKLTTDDLPLFIGITSDLFPGIQVPTVDYDELIGY
ITNEAIKLKLQPIPALITKVIELYETKNSRHSTMIVGQSNTGKSATWRTLQNTLTTMKRD
GKPGFNVVHEFPINPKALNLGELYGEYNLSTGEWSDGVISSIMRKTCADQSPDEKWIIFD
GPVDAVWIENMNSVMDDNKILTLINNDRITLPEQVSLLFEVEDLAVASPATVSRAGMVYN
DYKDLGWRPYVDSWLEKYKNQPEFIEEMNQHFDTYVDKVLEFKRSQCNELITLPEPNAVQ
SLCKLLEVLATPQNGVELLDDRDAFNSMCKLWFFFCMIWSLCASVDEEGRQKMDNFVREM
EGAGFPLRDTVYEYYVDVRQRGFVSWEEKLSPSWKFPTGTPFYKITVPTVDTIRYDYLVN
VLLTNGFPVLLVGPVGTGKTSTAQSVVGALDPHKYSLLVLNMSAQTSSRNVQEAIESRVE
KRTKGIFVPGGGKTMIAYMDDFNMPMKDTYGSQPPLELIRQWIGYGFWYDRQNQSQKFVQ
KMQLIGSMGPPGGGRNTVTNRLISKFNLVNMTFPAEKQIARIYGTMLNQQLLDFHQEVKA
LASDITMATIGMYNSVVLHMLPTPMKMHYLFNLRDISKVFQGLLRSHKDYQYSKQSFLRL
WIHETFRVFNDRLVDDQDREWFVSALNEQLGQYFESTFHGLCPEKRCPIFGSFMNAWNIY
EDLRDVGAVRSYAEGQMDEHNATAGVVRLDLILFRDAVEHICRIVRVISEPRGNMLLVGI
GGSGRQSLSRLAAYMCELTTFQIEVSKHYHVPEFREDLKSLYYLAGVENKPSSFLFNDTQ
IVEEQFLEIVNNMLSTGEIASLYKSDELEDIKNKLSKDATKAGISPTAEAIYQFLIQRVR
ANLHVILCMSPIGDAFRNRLRQYPALINCTSIDWFHEWPREALLEVGNKFLMNLDFTLTI
TGDKRTEEVASETPAALLEDQMRGAIASTFSLIHDTVSQFSRRMSVEMKRYNYVTPTNFL
ELVAGYKQMLGEKRLELSEQANKLRNGLFKLDDTREKVNEMAVELAATQQQVQRSTAECE
EYLVSIVSQRRDADETQKLVTARSVRIAEESKVCKRLEEIARADLATVEPALQEAMMALD
ALSKKDISEIKSFTRPPARVEMVLEAVMILKNSEPTWAESKRQLGDVNFINTLRDFDKDH
ISDKTLRTISKYTSNPEFEPEKVGIVSNAAKSLSMWVIAMEQYGKLYRIVAPKREKLEAA
LASLREKETALAEARAQLQKLQEELERLQQVYDAKMKEKEDLISLEELLKLKLERAAMLV
DGLSGERVRWESSVRELDGLFDSLPGDCLIATAFVSYLGPFVSNYRDELVRIWTAEVLEK
EIPSSRSLDVKEFLSDPTTIREWNIQGLPSDDFSTENGIIITRGTRWPLVIDPQAQAAKW
IRNMETKNTLRIIDFGQPDFAKILEHAIQFGKPVLLQNVGETLEPVMDSVLQKAFIKTGN
QVMIKFNDKMIGFNDKFRLFITTKLSNPHYAPEISTKTTLCNFAIKEQGLEAQLLGIVVR
KEKPQLEEQKDNLVLTIATGKRNLKELEDKILYLLSVTSGSLLDDLDLLTTLQTSKSTAI
TIQESLVVSEETEKEIDAAREGYRACSKRASLLFFVLNDMSLIDPMYQFSLDAYISLFSI
SIDKSPKSSDLSERIDSLNGYHTYALYRNTCRGLFEQHKLLFSFHMCIKILEAQDKIYQS
EYSFLLTGGIVVDRESQPDKPVAWLPDESWDSITELEKLPGFHGLVESFEQSPRDWHKWY
LANDPETEPLVGEWEDRCNEFQKMLIIRSCRADRMTSCLRSFIVRNLGQAFVEPPVLDVK
AVLDDSTARTPLIFVLSPGVDPTGALMQLAENHDMAHRFMTLSLGQGQAPIATRMIEIGS
KEGAWVFLANCHLSLSWMPKLDKIVENLGNSKDVHPEFRLWLSSSPTPQFPISILQAGIK
MTTEPPKGLRANMKRLYGLISEPQFEICNAKAKYKKLLFALVFFHSVLLERKKFQQLGWN
VIYSFNDSDFEVSENLLQVYLDEYPETPWDALKYLIAGICYGGHVTDDWDRRLLMAYVED
YMNESLLNVSHYRLSSLPTYHVPRDGSLETYRDFINALPMTDRPEAFGQHPNADITSLII
ETRLTFETLMSLQMQVVDSAETMSTEDRVIQLSQDIISKLPKPIDYERTERLIGPYKKPL
DVVLLQEIIRYNDLLYQTRSSLEELCRAIQGLVVMSSELEEIFTCVQEGRVPSGWSRAYP
SLKSLGAWTRDLVLRVEHFSKWAETTQPPVLFWLAAFTFPTGFLTAVLQTAARRSGVSID
TLSWEFDVFKGKDEAALLMTPPEDGVYVRSMFLEGAGWDRKLGALVDPAPMQLFCNMPVI
HFKPTEQTRKKTRGLYSCPCYYYPQRCGDQGRPAYVVTVDLNAGAESAAFWTKRGTALLL
SLAT
NT seq 12975 nt   +upstreamnt  +downstreamnt
atgctgggcttaaccgtaatatatcagccgagggaggcctgtgagctgatcgccgaggag
gcgagcgccgataaggagttggtaaagcggcttgaaggggtcgtcgtccactggttgagg
caaatcaggatcgccctcggggaccaggatcagagcactgtgggagagttgctctgcttt
aaggacgagtatgacttctggctctaccgctatgataacctacgcggactaaggcagcag
ctcgagacaaagtgctctcgaggagtactgtccgtcttgggcttggcgcactcgacgcac
ctgcgacaactccagctgctcatcgaggagatcgagcgagctactcgagaggccaagtcc
aacgtcgagttcctggctatgctcgaggagccctgtcttcgcggtctaggcgattctcgt
cgtccgatcgacttactcgaccgtctggccgaggtcattcaaatttcccgcgtcatctgg
atgaactcgccctacctcggcaacgagcgcaggatgaccaggctgttcgaggtcatcggt
aaccaggtcatcgaggtctgccggaacgccgtcaacctggacgaactgttctccgggatg
accaggaagaccatggagatgctcctcgagagcatcgacgtctgtcagcgctacaaggat
ctttaccacgagatctcgagggcccataacaagctgacgcatcacaagtgggagctgagg
agcgagcaagtttttcgatacgtggacgcgttcgtcgtcaggtgccagaacctcgttgag
atttcgcaggcgatgatcgacttcgccagaatggatgaaacaaacgagatgccccgtata
cgattcaatggaaccaaaggccccgagcacgaacgaatgtgtctgaagattgagcagcgc
tttagtgagctattatcctggctgcgacggatctcccctaagatcctggatgtccgtcag
tcaacctggtacgacgacatgtcgctttttcgaagcgagattaggaaactcgagctggcc
gtggaaaacctcatggaagacgcgttcgaggaagctggaaacatcgaggattccttgcag
acgctccatggattccggtatttcatgcgccgtgagaacctgcaaaaacaatttgacatg
aagatcggcattatctggcagatgctggacaccgagattcagacgacaaagcaagaaatt
atatcggaaaagtccgagtacccgtcgttcagcccatacttcgcaggtcgtgccttaaat
ctcaaaatgaagtccgacaggctaacgagactgtcccttcaattgcgcgagtgcacgtgg
caacgatccggtgaccctacaggcaacgaggctcacgccaaggcctttcatcactgcaac
gctctcgtcgagtctatcgccggccagattgccgatctctatcgcaaatggctcgccgag
ctcggcgataatccgcagagccggctcgatcgttacctcatgcgccgcgtttccgatgct
tgcggtgctgatgataaggctcggctgctcgagtgcaacgtcgatccgcgactgttgagc
ctctgtaaggaggccggttattggctcgatctccgattcgagctaccggtcagcgtccag
ctgataaacggccgctggagaagcctacagttcgtctacgagaacgtcctggccatcgtc
ggagcttacaacaagatcatccaagcactgtccgacgaagaaaagcctctttttcgtgaa
cttattcgtcaagttgataagaaaattcggccaggcttaactaaactcacgtggaaatct
gactacatcgaagattacattaaagattgcaacacccaaacggccaaattacaggaattt
atagacacatacaaaaaatgcaaccttgaaattttcaaaatttgtgaaagcatttgtggt
gtagtcatgattaaaattagacacaatcatgtttatgaattagacgaactacttgacgaa
atggagacctcaagaaatgaagcttttgatatcttcatggaaaaatacaaactgatagta
aaatatttgttggtcgtttacgaaggatttcaaccagtcatagagcattgcttgactgaa
tggaaactatatctgctgaactttgataaattattaaaggaagctttcaagctctcgata
aaaaattctttattaatcatgtatgaatctctgcacggagatggcacggtatctccctct
cctatccttcagctcaaagccgatttagtgaacaataagatcaatttcactccgtcgttg
actgacgtagcgcagatggtttccaatttttttcacaaacttctagatttattgaaaata
attcctagcgtagtggaaaagtttgaattacacgatttccaaactaagccttactggaaa
gcatatctcgaggacgaggacctcgatcgatcgcgacagatgtcgaacaacgaagtttct
tattgcttcacacaagtgcagaactacttgacaacgtgggagccttttcgggacatatgg
gaggtcaacaaagatttatttattcagagatacgaaaagctaaagccgacagttgccttg
ttcgacgcggacatcggcaggtatgcggaagtggcgaataatgtacaaatgcaggagacc
gttgtgacagtccattttttggagataaacgtggatcgattgaaagctgcaatcgtccag
cagtgtagcctgtggcagcaaaaattgactggattgctgctggaattgacggaagggaag
gttcatcacatttacaaatatgtcgcggacaatgggaagagaataacgaaggagccgatg
gatctcatcaccatgcaagccgcattgcagttgttcgagagactcgccgctgaaattcca
atggaagaaaaagaattccctactatacgccaacagtacgagactttagaaaaatatgaa
gtatctatgacattggaactgaaaaggaaaatacgagaccttgatgagtgctggacttct
tatttggaacttgtagcagtgtgcgaacttacattactgcagaaaaaggaagaatttaaa
aacaaattaatcaaagaggataacgttctaaaagaaaatgtaaagaatttgcttcaaaag
ttttacgaaagtgctccatttacttcggactggaagacaaaggatgcgagagcttggtta
caaaatatgcgaaaaaaggtgaataagacaagagaccaattaaacaagttgaagaaagat
ttgtcaatattcagtattagccaaccagattcaacggaattaaatactttactatcggaa
ctaactgcattggagctcgtttgggagttaacagacgaatgggaagcagcgtggaaacgt
tacaaatatggcaatttctggtcaatcgaaatagacgaaatggatgaaacagctaatgtt
ttatttcgcaaattgacgagattaagtcgtgaattaaaagagaaaaattggagtatagtg
gattccacgcgatcaagagtagacaatttccgtcgaactctacccctcatcatagacttg
aagaatcctgcaatgagagatcgtcattggacaaaagttatgcagtcgatgggaacggat
ttcgatcagaagtctgatgaattcactctagacgctatagcagcaatgcagatgcacaat
tttgctgaagaaatcgctgacatatctaattcggctactatggaactcgcaattgagacg
ggtttgaaaaacatttccgagatatggaaagcaatgccgctaatcatggttccctacaaa
gaaaatggaatatacaggttaaaaacagtagatgacatcatgcaagctttagaagagcac
caagtgcagctatctgcgatgaaatcgacaaagtttgtcgatgctttcgctgccgaagtt
gattactgggagcgagctttatcgacggtcggagaaattctagaaatggtattaagtgtt
cagaaaagctacatgtacttggacaacatcttcagcgcggaagacatcagaaagcagctg
cctcaagagacggatgattttgacaaactgaccgcctcgtggaaggagataacttggcga
atggcctcgagtaaactcgcactgcaagctactcttgaaccacccggcttactcgatacc
ctgaacgaactgaacaacaagttggaagccattcaaagagagctcgagcaatacctcgaa
acaaagaggcacgtcttcccgagattctacttcatctcgaatgacgatcttctcgagatt
ctcgctaattcaaagaagcccgagttgattcagccccacataaaaaagcttttcgacggc
atcaagcacataaagctcggcaagtcggtatcgggaaaagccgttgcagaaggaatgtcg
tcttcggaaggcgagtacacggaatttctggaaccagtgcttctcgagggacaagtagaa
gtttggctctgttacatcgagtcggcgatgcggagaactctgcgcgaggttttacggcag
tgccgagcggccctgcgaaaaatgtcagcaaaacgggacaagtgggtgaaggagtggcag
agtcagtccggaataacgtccactcagatacagtggaccagcgattgcacacgtgtcctg
cagcaatgcaagctgctcgagtcgaaaaagcctttaaaaaagctaaagaaacggcagaac
caagcgctggccaagtattccgaggctgtgaggggaaagctcgacaggctgcagaggctc
aagtttaaagccatcgtcgtcattgagattcacgccagggacgttatcgagaggatgtac
aagtccaattgtcgagacgtttcctcgttcgaatggttgtcccaattgcgcttctactgg
gacagggacgtcgacgactgcgtcgttcgccagacgaacacctccttcgtctacggctac
gagtaccttggaaattccgaacgactcgtcatcaccccgttgaccgacagatgttacata
acactgacaacggcgctgcacttgcatcgaggcggcagcccgaaaggtccggcgggtacc
ggcaagacggagaccgtcaaagacctcggcaaagccctcggctttaacgtcatcgtggtg
aattgctccgagggcctcgactacaagagcatgggacgaatgttttccgggctcgcgcaa
accggcgcctggggatgcttcgacgaattcaatagaatcaacatcgaagttctgtcggtg
gtggcccagcagattctctcgatattaacagccctctcgcaaaagctgactagattcgtc
ttcgaagggacggaaatttccctggttagtacgtgcgggattttcataacgatgaatccg
ggctacgctggtaggaccgagctgccggacaacttaaaatcaatgtttcgacccatttcc
atgatggtgccggacagcagcatgatagcggaaatcaatttgttcggcgagggctttcag
aatacacgttctcttgcaaagaaggtggatacgctgtatgccctggccaaacagcaactt
agcaaacagtttcattacgattttggacttcgtggaatagtgactctgactaggtatgct
gggaagaaaagaagacagtacccgaaccttcctgacgaagaagtcgttattctggcgatg
aaagacatgaacatagcgaaactcactacggacgatctgccactcttcataggaataaca
tccgaccttttcccgggcattcaagtaccaaccgtcgactacgacgagctcattggttac
ataactaacgaagcaatcaagctgaagttgcagcctatcccggcgcttatcaccaaagta
atcgaactttacgagacgaaaaactcacggcattcgacaatgatagtcggccaatcgaat
acaggcaagtcggccacatggcggaccctacagaacacactgacgacaatgaagagagac
ggaaagccgggctttaacgtcgtgcatgaatttcctatcaatcccaaggccctgaatctt
ggcgaattatatggagaatataatttatcgacgggcgaatggtccgacggggtgatttcg
tcgataatgcgaaaaacttgcgccgaccaaagcccggacgaaaagtggatcatatttgac
ggaccggttgacgctgtttggattgaaaatatgaatagtgtcatggatgacaataaaata
ttgacgctgatcaacaacgatcgcattactctaccggaacaagtttcacttctcttcgaa
gtcgaagatctggccgtagcttccccagccacggtttctcgtgccggtatggtttacaac
gattacaaggatctcggttggaggccttatgtcgactcgtggctggaaaaatataagaac
caaccggaattcatcgaggagatgaaccagcatttcgacacttacgttgacaaagtcctc
gagttcaaaaggagccagtgcaacgagctcattacgcttccggaacctaatgccgtgcaa
tcactttgtaaactcctcgaggtcctggccacgccgcagaatggagttgagctattagac
gaccgggacgcttttaacagcatgtgtaaattatggtttttcttctgcatgatctggtca
ctgtgcgcttccgtggacgaggagggccggcaaaaaatggataatttcgtgcgggagatg
gagggcgccggctttcccctccgcgacacggtctacgaatattacgtcgacgtccgacaa
cgtggcttcgtctcctgggaagaaaaattgtcgccctcctggaagttccctactggaacg
cccttttacaagatcacggtaccgacggtggacacgatccgctacgattacctcgtcaat
gtgctgctgaccaacggatttccagttttgctggtcggacccgttggcactggaaaaacg
tccactgctcagtcggtggttggtgccttggatccgcacaagtacagcctgctcgtgctg
aacatgtcggcgcagacttcgtcgagaaacgttcaggaggcgatcgagagccgagtggag
aaacgtacgaaggggatcttcgtgcccggcggtggtaaaacaatgatcgcctacatggac
gacttcaacatgcctatgaaagacacttacggctctcaaccgcccctggagctcattcgg
cagtggatcggttacggattttggtacgaccgtcagaatcagagccaaaagttcgttcag
aaaatgcaactgatcggctcgatgggcccgcccggaggtggtaggaacacggtaacgaac
aggctgatctccaaattcaacctcgtcaacatgacgtttcccgcggagaagcaaatcgcg
aggatatatggcacgatgctgaatcagcagttattagattttcaccaagaagtcaaggct
ctcgcgagcgacatcacaatggccacgataggcatgtacaatagcgtcgttcttcacatg
ctgcccacaccgatgaagatgcattacttgttcaacttgcgggacatttcgaaggtcttt
caaggcctgctgcgcagccataaagactaccaatactcgaagcagagcttcctgcgcctc
tggattcacgagaccttccgcgtcttcaacgatcgactcgtcgacgatcaggacagagaa
tggtttgtttctgcgctgaacgagcagctcggtcaatactttgaatcaacatttcacggg
ctttgtccggaaaaaaggtgtccaattttcgggagctttatgaacgcttggaacatctac
gaagacctgagggacgtcggtgccgtacgcagctacgccgagggccagatggacgagcac
aacgcgacggccggcgtcgttcgtcttgacctcatacttttccgggacgccgtcgagcac
atatgccgcatcgtgcgtgtaatatcggagccacgaggcaacatgctgctggtcggaatc
ggtggaagtgggcggcagtccctctcgcgtctggccgcttacatgtgcgagctgacaacc
ttccaaatcgaggtttcgaagcattaccacgtgccggaattccgcgaggacctcaaaagc
ctctactacttggcgggcgtcgaaaacaagccttcgagcttcctcttcaatgacactcaa
atcgtcgaggagcagttcctcgaaatcgtgaacaacatgctcagcaccggggaaatcgct
agtttgtacaagagcgacgagctcgaggacattaaaaacaagctgtcgaaggacgccaca
aaggccggaataagcccgacggccgaggcgatatatcagtttctgatccagcgggtgcgg
gcgaacctacacgtgatcctgtgcatgagcccgatcggcgacgctttccgaaacagattg
cgccaatatccggcgctgatcaactgcacgagcatcgattggttccacgagtggccgagg
gaagcgctcctcgaagtcggtaacaagttcctcatgaatcttgattttactctgaccatt
accggggacaagaggaccgaggaagtggcaagcgaaacaccagcggctctgctcgaggac
caaatgcgcggcgccattgcttcgaccttttccttgattcacgacacagtctcccaattt
tcccggcgaatgtccgtagagatgaaacgttacaactacgtgacgcctacgaatttcctc
gagctggtcgccggatataaacaaatgctcggggagaagcggctcgagttgtcggagcag
gcgaataagctgcgcaacgggctgttcaagctcgacgacaccagggaaaaagtgaacgag
atggcggtggagcttgcggcgacgcagcaacaggtccagcgctcgacggccgagtgcgag
gagtacctcgtgagcatcgtaagtcagaggcgcgacgccgacgagacgcagaagctcgtt
acagcgagatcggtgaggatagccgaggagtccaaagtctgcaagaggctcgaggagatt
gcccgagccgacctggccaccgtcgagcccgctctgcaagaggccatgatggctttggac
gctttgagtaagaaggatatatcggaaatcaagtcgttcaccagacctccggccagagtc
gaaatggtgctggaagcggtgatgattctgaaaaattccgaacccacgtgggccgaatct
aaacggcaactaggagatgtcaatttcataaacacgcttagggacttcgacaaggaccac
atctctgacaaaacgctgcgcaccatcagcaagtacacttccaatcccgaattcgaaccg
gaaaaagtcggcatcgtgtccaacgctgcgaaatctctgagcatgtgggtcatcgccatg
gagcagtacggaaagctttacagaatcgtggcgccgaaacgggaaaaacttgaagccgcg
ctggcatctctacgcgagaaagaaactgctttagccgaggcgagagcgcaattgcaaaag
ttgcaagaggagttggagcgactgcagcaagtgtacgacgcgaagatgaaggaaaaagaa
gacttaattagcttggaggagttattgaagttgaagttggagcgcgcagctatgttagtg
gatggtctctccggagagagggtcagatgggagagcagcgttcgggaactcgacggcttg
ttcgattcgttgccgggcgattgcctaattgctaccgctttcgtctcctacctgggaccc
tttgtttctaattacagggatgagctcgtgcgcatctggactgcagaggttctcgagaaa
gagattccaagttcgcggagtctcgacgtgaaggaatttttgagcgaccctacgacgatc
cgagaatggaacatccagggcttgccgtcggacgactttagcactgagaacggaataatc
atcacgaggggcacgaggtggccacttgttatcgatccgcaagctcaggccgctaaatgg
attaggaacatggagacgaagaacacgctgcgaatcatcgacttcggacagccggatttc
gcgaaaatcctcgaacacgcaattcagttcggaaaaccggttttacttcaaaacgtggga
gagactctagagcctgtgatggattccgtgcttcaaaaagcttttattaaaacaggcaac
caagtgatgattaaattcaacgacaaaatgatcggcttcaacgacaagttccggctgttc
atcacgacgaaactctcgaacccgcactacgcccccgagatatcgacgaaaaccaccctc
tgcaacttcgccatcaaggaacaaggtctggaggctcaactgctcggcatcgtcgtcagg
aaagaaaagcctcagctcgaggaacaaaaggataatctggtcctcaccattgccaccgga
aaacgcaacctgaaagagctcgaggacaaaatcctctacttactgagcgtgacgtccggc
tctctccttgatgatttggacttgctcacgactctgcaaacttctaaaagcacggctatt
acgattcaggagtcgttagtggtatccgaggagaccgagaaagagatcgacgccgcgaga
gaaggctatcgagcctgttccaagagggcgtcgctgcttttcttcgttttgaacgacatg
agcttgatagatccgatgtatcagttttccctggacgcttacatatcgctgttcagcatt
tcgatcgacaagagtccgaagagttcggatctaagtgagaggatagattcgttgaacggt
taccatacttacgctctgtacagaaacacttgcagaggtctgttcgagcagcacaaactt
ctgttctcgttccacatgtgcataaagatcctcgaagcacaggacaaaatttaccaatcc
gagtactcgttcttactgactggcggtattgtcgtagaccgtgagagccagcccgataaa
ccggtagcctggttgccggatgaatcctgggacagcataaccgaactcgagaaactgccc
ggttttcacggactcgtcgagtctttcgaacaatcaccgcgtgattggcacaaatggtac
ttggcgaacgatccggaaaccgagccactggtgggcgagtgggaggaccgctgcaacgag
ttccagaagatgctgataatccgcagttgtcgcgcggatcgcatgacgagctgtctgcgc
agcttcatcgtgcgcaatctcgggcaagcttttgtcgagccgccggtactcgacgtcaag
gccgtcctcgatgactccaccgcccgcacacccctgatattcgtcctgtcaccgggtgtc
gatcccaccggcgcactcatgcagctcgccgagaaccatgacatggctcacaggttcatg
acgctgtcgctcggccaaggacaggcaccaattgcaacgaggatgatcgaaatcggttcc
aaggaaggcgcctgggtatttctggcaaactgccacttatcattaagctggatgccgaag
ctagacaaaatcgtcgagaatttgggcaacagcaaagacgtacatcccgaattcagactc
tggttaagctcgagtccgaccccgcagttcccaatatcgatcctccaggccggaataaag
atgacgacggagcccccgaaaggtctgagagccaacatgaaacgtctctacgggctgata
agcgagccgcaattcgaaatttgcaatgccaaagccaagtacaagaagctcctctttgcg
ctcgtatttttccactcggtcctgctcgagcgaaagaaattccagcagctcggctggaac
gtcatttacagcttcaatgattcggatttcgaggtctcggagaatctgctgcaagtctat
ctggacgagtacccggagacaccgtgggacgctttgaagtacctgatcgcgggcatctgc
tacgggggtcacgtgaccgacgactgggatcgtcgactgctgatggcttacgtcgaggac
tacatgaacgagtcgctgctgaacgtgagccactatcggctctcgtcactgccgacgtac
cacgtgccacgtgacggctccctcgagacctaccgagatttcatcaacgctttgccgatg
actgacagacccgaagctttcggacaacatcccaacgctgacataacgtccctcatcata
gagacgagactgaccttcgagacgctgatgagcttgcagatgcaggttgtcgacagcgcg
gagaccatgtccaccgaagaccgggtgatccagctctcccaggacataatatccaagctt
ccgaaaccaatcgactacgagcgcaccgagcgccttataggcccgtacaagaagcccctg
gacgtagttctcctccaagaaatcattcgctacaatgacctactgtaccagacccgttcg
agtctagaagaactctgccgagcgattcagggcctggtcgtcatgtcgtccgagctcgag
gaaatcttcacctgcgtccaggagggccgtgttccgagcggctggtccagggcctacccg
tcgcttaaatccctcggagcctggacacgggacctggtgctcagagtcgagcacttctcc
aagtgggccgagacgacgcagccacctgtgcttttctggctggccgcctttaccttcccc
acgggatttctcacggctgtgctgcaaaccgccgcgaggcgctccggcgtatccatcgac
acgctctcctgggaattcgacgtctttaagggtaaagacgaggctgcgctgctgatgacg
ccgccagaggacggcgtttacgtaagatccatgtttctcgaaggcgctggctgggataga
aagctcggagctcttgttgatcccgcccctatgcaactgttttgtaacatgccggttatc
catttcaaaccaacggagcagacgaggaagaaaacaagaggtctgtacagctgtccctgt
tactactatccacaacgctgcggagaccaaggcagacccgcctacgtagttacggttgat
ttaaatgctggcgcggaaagcgctgctttctggaccaaacggggtacagctttactttta
agtcttgctacgtaa

DBGET integrated database retrieval system