KEGG   Ornithorhynchus anatinus (platypus): 100074671
Entry
100074671         CDS       T01045                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04062  Chemokine signaling pathway
oaa04068  FoxO signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04137  Mitophagy - animal
oaa04140  Autophagy - animal
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04210  Apoptosis
oaa04211  Longevity regulating pathway
oaa04213  Longevity regulating pathway - multiple species
oaa04218  Cellular senescence
oaa04360  Axon guidance
oaa04370  VEGF signaling pathway
oaa04371  Apelin signaling pathway
oaa04540  Gap junction
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04625  C-type lectin receptor signaling pathway
oaa04650  Natural killer cell mediated cytotoxicity
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04714  Thermogenesis
oaa04720  Long-term potentiation
oaa04722  Neurotrophin signaling pathway
oaa04725  Cholinergic synapse
oaa04726  Serotonergic synapse
oaa04730  Long-term depression
oaa04810  Regulation of actin cytoskeleton
oaa04910  Insulin signaling pathway
oaa04912  GnRH signaling pathway
oaa04915  Estrogen signaling pathway
oaa04916  Melanogenesis
oaa04917  Prolactin signaling pathway
oaa04919  Thyroid hormone signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04926  Relaxin signaling pathway
oaa04929  GnRH secretion
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa04935  Growth hormone synthesis, secretion and action
oaa05010  Alzheimer disease
oaa05022  Pathways of neurodegeneration - multiple diseases
oaa05034  Alcoholism
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05163  Human cytomegalovirus infection
oaa05165  Human papillomavirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05170  Human immunodeficiency virus 1 infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05207  Chemical carcinogenesis - receptor activation
oaa05208  Chemical carcinogenesis - reactive oxygen species
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05216  Thyroid cancer
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05230  Central carbon metabolism in cancer
oaa05231  Choline metabolism in cancer
oaa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oaa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100074671 (NRAS)
   04012 ErbB signaling pathway
    100074671 (NRAS)
   04014 Ras signaling pathway
    100074671 (NRAS)
   04015 Rap1 signaling pathway
    100074671 (NRAS)
   04370 VEGF signaling pathway
    100074671 (NRAS)
   04371 Apelin signaling pathway
    100074671 (NRAS)
   04068 FoxO signaling pathway
    100074671 (NRAS)
   04072 Phospholipase D signaling pathway
    100074671 (NRAS)
   04071 Sphingolipid signaling pathway
    100074671 (NRAS)
   04151 PI3K-Akt signaling pathway
    100074671 (NRAS)
   04150 mTOR signaling pathway
    100074671 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100074671 (NRAS)
   04137 Mitophagy - animal
    100074671 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100074671 (NRAS)
   04218 Cellular senescence
    100074671 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100074671 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100074671 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100074671 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100074671 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    100074671 (NRAS)
   04660 T cell receptor signaling pathway
    100074671 (NRAS)
   04662 B cell receptor signaling pathway
    100074671 (NRAS)
   04664 Fc epsilon RI signaling pathway
    100074671 (NRAS)
   04062 Chemokine signaling pathway
    100074671 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100074671 (NRAS)
   04929 GnRH secretion
    100074671 (NRAS)
   04912 GnRH signaling pathway
    100074671 (NRAS)
   04915 Estrogen signaling pathway
    100074671 (NRAS)
   04917 Prolactin signaling pathway
    100074671 (NRAS)
   04921 Oxytocin signaling pathway
    100074671 (NRAS)
   04926 Relaxin signaling pathway
    100074671 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    100074671 (NRAS)
   04919 Thyroid hormone signaling pathway
    100074671 (NRAS)
   04916 Melanogenesis
    100074671 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100074671 (NRAS)
   04726 Serotonergic synapse
    100074671 (NRAS)
   04720 Long-term potentiation
    100074671 (NRAS)
   04730 Long-term depression
    100074671 (NRAS)
   04722 Neurotrophin signaling pathway
    100074671 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100074671 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100074671 (NRAS)
   04213 Longevity regulating pathway - multiple species
    100074671 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100074671 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100074671 (NRAS)
   05206 MicroRNAs in cancer
    100074671 (NRAS)
   05205 Proteoglycans in cancer
    100074671 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    100074671 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100074671 (NRAS)
   05203 Viral carcinogenesis
    100074671 (NRAS)
   05230 Central carbon metabolism in cancer
    100074671 (NRAS)
   05231 Choline metabolism in cancer
    100074671 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100074671 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100074671 (NRAS)
   05225 Hepatocellular carcinoma
    100074671 (NRAS)
   05226 Gastric cancer
    100074671 (NRAS)
   05214 Glioma
    100074671 (NRAS)
   05216 Thyroid cancer
    100074671 (NRAS)
   05221 Acute myeloid leukemia
    100074671 (NRAS)
   05220 Chronic myeloid leukemia
    100074671 (NRAS)
   05218 Melanoma
    100074671 (NRAS)
   05211 Renal cell carcinoma
    100074671 (NRAS)
   05219 Bladder cancer
    100074671 (NRAS)
   05215 Prostate cancer
    100074671 (NRAS)
   05213 Endometrial cancer
    100074671 (NRAS)
   05224 Breast cancer
    100074671 (NRAS)
   05223 Non-small cell lung cancer
    100074671 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100074671 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    100074671 (NRAS)
   05161 Hepatitis B
    100074671 (NRAS)
   05160 Hepatitis C
    100074671 (NRAS)
   05163 Human cytomegalovirus infection
    100074671 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100074671 (NRAS)
   05165 Human papillomavirus infection
    100074671 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100074671 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100074671 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    100074671 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100074671 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100074671 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100074671 (NRAS)
   01522 Endocrine resistance
    100074671 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oaa04131]
    100074671 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oaa04147]
    100074671 (NRAS)
   04031 GTP-binding proteins [BR:oaa04031]
    100074671 (NRAS)
Membrane trafficking [BR:oaa04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100074671 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100074671 (NRAS)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100074671 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100074671 (NRAS)
  Exosomal proteins of breast cancer cells
   100074671 (NRAS)
  Exosomal proteins of colorectal cancer cells
   100074671 (NRAS)
GTP-binding proteins [BR:oaa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100074671 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 100074671
NCBI-ProteinID: XP_028924736
Ensembl: ENSOANG00000041833
Position
7:55327592..55337111
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCAVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggttggagccggcggtgtggggaaaagcgccctgacc
atccagctcatccagaaccacttcgtcgacgaatatgaccccaccatcgaggattcatac
cgaaagcaagtagttattgacggtgaaacctgtttgttagacatactggacacagccgga
caagaagaatatagtgccatgagagaccagtacatgaggacgggggaaggtttcctctgt
gtatttgccataaataatagcaaatcatttgctgatattaacctctacagggaacagatc
aagcgggtgaaagattcagacgatgtacctatggtgttggtgggaaacaaatgcgatctg
ccaacgaggacagttgacacgaaacaggctcatgaactcgccaagagctatggaattccc
ttcattgaaacctctgctaaaaccagacagggtgtcgaagatgccttttatacattggtg
agagagataagacagtaccgaatgaaaaaactcaacagcagtgatgacgggactcaaggt
tgtatgggactaccatgtgcagtgatgtaa

  All links  
Ontology (4)   
   KEGG BRITE (4)   
Pathway (80)   
   KEGG PATHWAY (80)   
Genome (1)   
   KEGG GENOME (1)   
Gene (6)   
   KEGG ORTHOLOGY (1)   
   RefGene (1)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
   Ensembl (1)   
   OC (1)   
Protein sequence (2)   
   RefSeq(pep) (2)   
DNA sequence (2)   
   RefSeq(nuc) (2)   
Protein domain (9)   
   Pfam (9)   
All databases (104)   

Download RDF
DBGET integrated database retrieval system