KEGG   Oreochromis niloticus (Nile tilapia): 100699103
Entry
100699103         CDS       T06104                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: MDS1 and EVI1 complex locus protein
  KO
K04462  ecotropic virus integration site 1 protein
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100699103
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:onl03000]
    100699103
Transcription factors [BR:onl03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100699103
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-met Zn-ribbon_8 PyrI_C
Other DBs
NCBI-GeneID: 100699103
NCBI-ProteinID: XP_005474559
Ensembl: ENSONIG00000005587
AA seq 1261 aa
MRSKGRARKLATSDGDDEIPLYPSDILDDVCGSDGDPTPSSALPEDPASPSLSDDESSPQ
DHLSFQHQSIFFPQEDLSIPFDFELRESTVPSGGLGIWSRRKVNVGERFGPYEGEHRPCL
QDPTQGWEILDGSGHVKFCVDASKPDIGSWLKHIQFAPAAKQHNLTACQIDDQIFYKVTR
EIFPGQELLLFMKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKKPCGMPPS
SFLNPGGDNDLKAQEPQDLRPLHMSQGLHECKECDQVFPDIQSLEAHSLSHSEEREYKCD
QCPKAFNWKSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHACSECG
KTFATSSGLKQHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMF
STTSSLNKHRRFCEGKNHFTAGGLFAQGMPLPGAPGLDKSALAMGHSSAGLADYFGASRH
HSGLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPAHAPVAGPGAELSKSPLLP
PSPGVQESQELLKALRKDGGSPGSQMPVSDSQGSSYTKQKNKQSDQSESSDLDDVSTPSG
SDLESTSGSELESDMDSERERGAARENGKGPKRKASEGGPQSPSLMGSSAAKDFPGPSLI
PSPLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGSLPYPSMFPLPFFPAFS
PPVYPFPDRDLRTAGLKGEPQSPADDSKKAQGKSSSESPFDLTTKRKEEKLASFASSKPE
MAQSMGQDQPLDLSLGARGRGRNPREEETKKNPNYEEEKGVVEIPKADTSLQHARPTPFF
MDPIYRVEKRRMSDPFETLKDKYMRPAPGFLFHPQFHLPDQRTWMTAIENMAEKLETFGS
LKPESGDLLRSVPSMFDFRAPPSALPDTLLRKGKERYTCRYCGKIFPRSANLTRHLRTHT
GEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGN
LSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFISNTSQNQTSPDPSEEGLNGGPFEEE
KPLMASHRSRDLEDEEAEELGADEEEGEEPSNTPEKSESKVLQSDLGDPIIQDEMDLSEP
NDLNLSCKTSPRRYKDEEEQSSYSALDHIHHFSEMRKLDESELSDGDGDGDEEDGSFGSP
SLTEAVKQPLFRKSKSQAYAMMLSLAEKDTLHPATHTPVTMWHSLARAAAESSAIQSLSH
V
NT seq 3786 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacgagtgacggcgatgatgagatacct
ctttatccatccgacatcttagacgacgtatgcggctctgatggggatcctacaccttct
tcggccctgccagaagacccggcatcaccttcactctctgacgatgagtcctctccacag
gaccatctgtcattccaacaccaaagcatctttttcccccaggaagatctgagcattccc
tttgactttgaattgcgagagtcaaccgttccatctggagggctgggcatctggagccgc
aggaaggtgaacgtcggggagcgatttggaccgtatgaaggagagcacaggccttgtctc
caagatcctactcaaggctgggagatcttggatgggtcaggccatgtaaaattctgcgtg
gatgccagcaaaccagatatcgggagctggctgaagcacatccagtttgcccctgcagcc
aagcagcacaacctgacagcgtgccagatagatgatcagatattctacaaagtcaccaga
gagatttttcctggccaggagctgttacttttcatgaaggctgaagagtattcatgtgat
acgatggctcctgatattcatgaggagaggcagtaccgctgtgaggattgtgaccagcac
tttgagtcccgcaaccagctgctggaccaccagaagaagccgtgtgggatgcccccctcc
tccttcctgaacccaggaggcgacaatgacctgaaagcccaagaacctcaagacttgcga
cccctccacatgtcccaaggactacacgaatgtaaagagtgtgaccaggtcttccctgat
atccagagcctggaggcccacagcttgtcccacagtgaggagagagaatataagtgtgac
cagtgtcccaaggccttcaactggaaatcgaacctgatccgacatcagatgtcgcacgat
agtggcaagcactacgaatgtgaaaactgctcaaaggtgttcacagaccccagtaacctc
caaaggcacattcgctcgcagcacgtcggggcgcgtgctcatgcctgttctgagtgtggc
aagacgtttgcaacgtcttcgggcctcaaacagcataagcacatccacagcagtgtcaag
cccttcatgtgtgaagtctgccacaagtcctacacccagttctctaacctttgccgccac
aaacgcatgcacgctgactgccgcacacagatcaaatgtaaggactgtgggcaaatgttc
agcaccacctcttccctcaacaagcaccggcgcttctgtgaagggaagaaccacttcaca
gcaggagggctgtttgcccagggtatgccactccctggggcccccggcttggacaaatca
gctcttgcaatgggtcacagcagtgcaggacttgctgattattttggggctagccgacat
cacagcggacttacgttccctgctgccccggcatttcctttcagcttccctggcctgttc
ccctctggactttatcatcggccgccgctcattcctgccacaacttctcctgtcaggcag
ccagcccacgcacctgttgctggacctggagcagagctgagcaagagtcctttgctgcct
ccaagccctggtgttcaggagtctcaagaacttctcaaagctctccgcaaagacggcggc
tcacctggaagtcaaatgccagtgtcagacagccagggctcatcctataccaagcaaaag
aacaagcagagtgaccagtctgaaagcagcgacctggatgatgtcagcacacccagtgga
agtgatctggagagcacgtcaggctccgagctcgaaagcgacatggacagtgagagggag
aggggggctgctcgagaaaacggaaaaggtccaaagaggaaggccagtgaaggaggccct
caaagccccagcctgatgggcagcagcgctgctaaagactttccaggcccttccctcatc
ccttccccgctggatgaacacacagctgtaacaggagctgtgaatgactctattaaggcc
attgcctcaattgccgagaagtattttggctccacagggctagctggcctgcaggacaag
aaggttgggtctcttccctatccttctatgttcccactgcctttcttcccagcgttctct
cctccggtttaccccttcccagacagggacctcagaactgcaggcctgaagggggagcca
caatcacctgcagatgactccaagaaggcccaagggaagtcttcatccgagtccccattt
gacctcaccaccaagcgaaaggaggaaaagttagcatcctttgcgtcttccaaaccagaa
atggcccaatctatgggtcaggatcagccactagatttgagccttggggccaggggccgt
gggcgtaatccaagagaggaggagacaaaaaagaatccaaattatgaagaggagaaagga
gtggtggagatcccaaaagcagacacttccttacaacatgctaggcccacccctttcttc
atggaccccatctatagggttgagaagaggagaatgagcgatccgtttgagactctgaaa
gacaagtacatgcgacccgctccgggcttccttttccatccacagtttcatttgccagat
cagagaacttggatgaccgcaatcgagaacatggcagagaagctggaaacgtttggctcc
ttgaagccagagtctggtgacctgctgcgctcggttccctccatgtttgacttcagagct
ccgccctcggcgcttcccgacacgctactgcgcaagggaaaggagcgctacacatgcaga
tactgtggaaaaatattccctcgctctgccaacctgacacgccacctgaggactcacaca
ggagagcaaccgtataggtgtaaatactgtgaccgctccttcagcatctcctccaaccta
cagcgtcacattcgcaacatccacaacaaggagaagccgtttaagtgccacctgtgcgac
cgctgcttcggtcagcagaccaacctggatcgtcacctcaaaaagcacgagaacggcaat
ctgtcaggaactgcaatgtcgtccccacagtctgaactggacagcagcagcgccatactg
gatgacaaagaggattcttatttcaacgaaataagaaattttatcagcaacacaagccag
aaccagacatcaccggacccctcagaggaagggctaaatggcggtccatttgaagaagaa
aagccactgatggccagccataggtcacgtgacctggaagatgaggaagcggaagagtta
ggtgcggatgaagaagaaggggaggagcctagcaacacccctgaaaaatcggaaagcaag
gtgctccaaagcgaccttggtgatcccatcatacaagacgaaatggacttgagtgagcca
aacgacttgaatctcagctgtaaaacttctccaaggaggtataaagacgaggaggagcag
agcagctactcagccttggatcacatccatcacttttctgaaatgcgcaagctggacgag
agtgaactgagtgacggagacggggatggggatgaggaggacggctcatttggttcccca
tctctgactgaggcagtcaaacagccgctctttaggaaatcaaagtctcaggcttatgcc
atgatgctgtccctggctgaaaaggacactcttcacccagctacccacaccccagtcacc
atgtggcacagtctggcacgggctgccgctgaatccagtgccatccagtccctcagccat
gtatga

DBGET integrated database retrieval system