KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386508Help
Entry
101386508         CDS       T05148                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13 isoform X1
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04270  Vascular smooth muscle contraction
oro04371  Apelin signaling pathway
oro04611  Platelet activation
oro04730  Long-term depression
oro04810  Regulation of actin cytoskeleton
oro04928  Parathyroid hormone synthesis, secretion and action
oro05163  Human cytomegalovirus infection
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101386508 (GNA13)
   04072 Phospholipase D signaling pathway
    101386508 (GNA13)
   04071 Sphingolipid signaling pathway
    101386508 (GNA13)
   04022 cGMP-PKG signaling pathway
    101386508 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101386508 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101386508 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101386508 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101386508 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    101386508 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101386508 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101386508 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101386508 (GNA13)
   04031 GTP-binding proteins [BR:oro04031]
    101386508 (GNA13)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101386508 (GNA13)
  Exosomal proteins of colorectal cancer cells
   101386508 (GNA13)
GTP-binding proteins [BR:oro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    101386508 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 101386508
NCBI-ProteinID: XP_004405823
UniProt: A0A2U3WBK7
Position
Unknown
AA seq 377 aa AA seqDB search
MADFLPSRSVLSVCFPGCVLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQVNGD
KMMAFDTRSPMASQGMVETRVFLQYLPVIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEADYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcgtgctg
acgagcggcgaggccgaacagcagcgcaagtccaaggagatagacaaatgcctgtcccgg
gagaagacctacgtgaagcggctcgtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgattaaaggtatgagggtgctggta
gatgctcgagagaagcttcatattccgtggggagataactcaaaccaagtcaacggagac
aagatgatggcgtttgacacccggtcccccatggcgtcccaaggaatggtggaaactcga
gtttttttgcaatatctccctgttataagagcattatgggcagacagtggtatacagaat
gcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagaagcagattacattccatcacaacaagatattctgcttgccagg
agacccaccaaaggcattcatgagtacgactttgaaattaaaaatgttcctttcaaaatg
gttgatgtgggtggtcaaagatcagagagaaaacgatggtttgaatgcttcgacagtgtg
acgtcaatacttttccttgtttcgtcaagtgagtttgaccaggtgctcatggaagaccga
ctgaccaatcgccttacagaatctctgaacatttttgaaacaatcgtcaataaccgggtt
ttcagcaatgtctccattattctcttcttaaacaagacagatttgcttgaggagaaagtg
caaattgtgagcatcaaagactatttcttagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcagcagaag
cctttgtaccaccacttcaccactgctatcaacacggagaacatccgcctcgttttccgc
gacgtgaaggataccattcttcacgacaacctcaagcagctcatgctacagtga

DBGET integrated database retrieval system